SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000069509 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000069509
Domain Number 1 Region: 1000-1044
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 0.00000000000000746
Family Nuclear receptor coactivator interlocking domain 0.00061
Further Details:      
 
Domain Number 2 Region: 123-189
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000288
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.032
Further Details:      
 
Domain Number 3 Region: 268-372
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000429
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.00054
Further Details:      
 
Domain Number 4 Region: 32-92
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000419
Family HLH, helix-loop-helix DNA-binding domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000069509   Gene: ENSMUSG00000005886   Transcript: ENSMUST00000068304
Sequence length 1393
Comment pep:known chromosome:GRCm38:1:13139159:13374083:-1 gene:ENSMUSG00000005886 transcript:ENSMUST00000068304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGMGENTSDPSRAETRKRKECPDQLGPSPKRSTEKRNREQENKYIEELAELIFANFNDI
DNFNFKPDKCAILKETVKQIRQIKEQEKAAAANIDEVQKSDVSSTGQGVIDKDALGPMML
EALDGFFFVVNLEGSVVFVSENVTQYLRYNQEELMNKSVYSILHVGDHTEFVKNLLPKSM
VNGGSWSGEPPRRSSHTFNCRMLVKPLPDSEEEGHDSQEAHQKYEAMQCFAVSQPKSIKE
EGEDLQSCLICVARRVPMKERPTLPSSESFTTRQDLQGKITSLDTSTMRAAMKPGWEDLV
RRCIQKFHTQHEGESLSYAKRHHHEVLRQGLAFSQIYRFSLSDGTLVAAQTKSKLIRSQT
TNEPQLVISLHMLHREQNVCVMNPDLTGQAMGKPLNPISSSSPAHQALCSGNPGQDMTLG
SNINFPMNGPKEQMGMPMGRFGGSGGMNHVSGMQATTPQGSNYALKMNSPSQSSPGMNPG
QASSVLSPRQRMSPGVAGSPRIPPSQFSPAGSLHSPVGVCSSTGNSHSYTNSSLNALQAL
SEGHGVSLGSSLASPDLKMGNLQNSPVNMNPPPLSKMGSLDSKDCFGLYGEPSEGTTGQA
EASCHPEEQKGPNDSSMPQAASGDRAEGHSRLHDSKGQTKLLQLLTTKSDQMEPSPLPSS
LSDTNKDSTGSLPGPGSTHGTSLKEKHKILHRLLQDSSSPVDLAKLTAEATGKELSQESS
STAPGSEVTVKQEPASPKKKENALLRYLLDKDDTKDIGLPEITPKLERLDSKTDPASNTK
LIAMKTVKEEVSFEPSDQPGSELDNLEEILDDLQNSQLPQLFPDTRPGAPTGSVDKQAII
NDLMQLTADSSPVPPAGAQKAALRMSQSRMIGSSTSRPSMPSGEWAPQSPAVRVTCAATT
GAMNRPVQGGMIRNPTASIPMRANSQPGQRQMLQSQVMNIGPSELEMNMGGPQYNQQQAP
PNQTAPWPESILPIDQASFASQNRQPFGSSPDDLLCPHPAAESPSDEGALLDQLYLALRN
FDGLEEIDRALGIPELVSQSQAVDAEQFSSQESSIMLEQKPPVFPQQYASQAQMAQGGYN
PMQDPNFHTMGQRPNYTTLRMQPRPGLRPTGIVQNQPNQLRLQLQHRLQAQQNRQPLMNQ
ISSVSNVNLTLRPGVPTQAPINAQMLAQRQREILNQHLRQRQMQQQVQQRTLMMRGQGLN
VTPSMVAPAGLPAAMSNPRIPQANAQQFPFPPNYGISQQPDPGFTGATTPQSPLMSPRMA
HTQSPMMQQSQANPAYQPTSDMNGWAQGSMGGNSMFSQQSPPHFGQQANTSMYSNNMNIS
VSMATNTGGLSSMNQMTGQMSMTSVTSVPTSGLPSMGPEQVNDPALRGGNLFPNQLPGMD
MIKQEGDASRKYC
Download sequence
Identical sequences E9PV80
NP_001289631.1.92730 XP_011236663.1.92730 ENSMUSP00000069509 ENSMUSP00000080413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]