SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000071396 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000071396
Domain Number 1 Region: 1744-1937,1989-2172,2206-2261
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 3.34e-112
Family DNA polymerase I 0.00000094
Further Details:      
 
Domain Number 2 Region: 382-549
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 6.02e-41
Family Achaeal helicase C-terminal domain 0.0035
Further Details:      
 
Domain Number 3 Region: 70-202
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.16e-22
Family Tandem AAA-ATPase domain 0.0021
Further Details:      
 
Domain Number 4 Region: 1576-1699
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.000025
Family DnaQ-like 3'-5' exonuclease 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000071396
Domain Number - Region: 247-335
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00598
Family RecQ helicase DNA-binding domain-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000071396   Gene: ENSMUSG00000034206   Transcript: ENSMUST00000071452
Sequence length 2265
Comment pep:known chromosome:GRCm38:16:37011786:37094992:1 gene:ENSMUSG00000034206 transcript:ENSMUST00000071452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLPRRSRKRRRSSSGSDTFSGDGDSFVSPQLRCGPVLSPPPGLGRGRRLTGTGTNKRRV
SDDQIDQLLLANWGLPKAVLEKYHSFGVRKMFEWQAECLLLGHVLEGKNLVYSAPTSAGK
TLVAELLILKRVLETRKKALFILPFVSVAKEKKCYLQSLFQEVGLKVDGYMGSTSPTGQF
SSLDIAVCTIERANGLVNRLIEENKMDLLGESILVCKNSEKSKGIALLQGSLEPVHSCLQ
RQGEVTASMIRAILEIIVGGVASTSQDMQTYAACTFLAAAIQEGKQGMQRNQDDAQLGAI
DACVTWLLENEFIQVAEPGDGTGGKVYHPTHLGSATLSSSLSPTDTLDIFADLQRAMKGF
VLENDLHIVYLVTPVFEDWISIDWYRFFCLWEKLPTSMKRVAELVGVEEGFLARCVKGKV
VARTERQHRQMAIHKRFFTSLVLLDLISEIPLKDINQKYGCNRGQIQSLQQSAAVYAGMI
TVFSNRLGWHNMELLLSQFQKRLTFGIQRELCDLIRVSLLNAQRARFLYASGFLTVADLA
RADSAEVEVALKNSLPFKSARKAVDEEEEAAEERRSMRTIWVTGKGLSAREAAALIVEEA
KMILQQDLIEMGVRWDPKSPLSSSTHSRTSTSEVKEHTFKSQTKSSHKRLASMGRNSIRA
SGSNDKPSPDAERGIDDCSEHADSLCKFQGNFEPQTPSICTARKRTSLGINKEMLRKSLK
EGKPSTKEVLQTFSSEKTRKTALSFSSEQVNNTLPSGRDRKYQKKSWGSSPVRDSGMHRG
DLQGQTMCTSALCEDSQKSLEEQNAEFRSPGLFAKHLPSCAKEKCKKPSLPLQRQQACSR
RSTESCAAVGHPAAGSSPAAARDRRGLAARETEKGNEALTENGGESQLQDTYPVSQYLEY
HSEKHTNTCTRQKTLTEGQAGSSYVARDSNDAAPIKCERMKLNSKDRDSNPCRQALGSYT
GRTEALQSTAKLGQAGGQCENLLNSSGVQGKTGAHATNRTEHSHASNPAFCDFGDSLDLD
TQSEEIIEQMATENTMQGAKAVVIMEEGSAMQNKCHSTPGDQHVPGAANTDHVDSKKVES
VKANTEKNINRGAPVSLIFHTQGENGACFKGNEHSVTDSQLNSFLQGFETQEIVKPIIPL
APQMRTPTGVEEESLPETSLNMSDSILFDSFGEDGFGQGQSPDIKANQPLLSEMTPNHFS
NPPHPQEDPVMTPTVSEPQGTQQQGVCLSGESIIFSDIDSAQVIEALDNMAAFHVQENCN
SVALKTLEPSDSAVLGNECPQGKLVRGDQNEGSPKPKLTETNQDNSFTWSGASFNLSPEL
QRILDKVSSPRENEKPKMIHVNLSSFEGNSKESHEREEINSDLGTVQRTSVFPSNEVKNR
TEGLESKARHGGASSPLPRKESAAADDNGLIPPTPVPASASKVAFPEILGTSVKRQKASS
ALQPGESCLFGSPSDNQNQDLSQELRDSLKDYDGSVADTSFFLQSQDGLLLTQASCSSES
LAIIDVASDQILFQTFVKEWQCQKRFSISLACEKMTSSMSSKTATIGGKLKQVSLPQEAT
VEDAGFPVRGCDGAVVVGLAVCWGAKDAYYLSLQKEQKQSEISPSLAPPPLDATLTVKER
MECLQSCLQKKSDRERSVVTYDFIQTYKVLLLSCGISLEPSYEDPKVACWLLDPDSKEPT
LHSIVTSFLPHELALLEGMETGPGIQSLGLNVNTEHSGRYRASVESVLIFNSMNQLNSLL
QKENLHDIFCKVEMPSQYCLALLELNGIGFSTAECESQKHVMQAKLDAIETQAYQLAGHS
FSFTSADDIAQVLFLELKLPPNGEMKTQGSKKTLGSTRRGNESGRRMRLGRQFSTSKDIL
NKLKGLHPLPGLILEWRRISNAITKVVFPLQREKHLNPLLRMERIYPVSQSHTATGRITF
TEPNIQNVPRDFEIKMPTLVRESPPSQAPKGRFPMAIGQDKKVYGLHPGHRTQMEEKASD
RGVPFSVSMRHAFVPFPGGLILAADYSQLELRILAHLSRDCRLIQVLNTGADVFRSIAAE
WKMIEPDAVGDDLRQHAKQICYGIIYGMGAKSLGEQMGIKENDAASYIDSFKSRYKGINH
FMRDTVKNCRKNGFVETILGRRRYLPGIKDDNPYHKAHAERQAINTTVQGSAADIVKIAT
VNIQKQLETFRSTFKSHGHRESMLQNDRTGLLPKRKLKGMFCPMRGGFFILQLHDELLYE
VAEEDVVQVAQIVKNEMECAIKLSVKLKVKVKIGASWGELKDFDV
Download sequence
Identical sequences ENSMUSP00000071396 NP_001152841.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]