SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000071494 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000071494
Domain Number 1 Region: 43-115
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000332
Family Calmodulin-like 0.048
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000071494
Domain Number - Region: 186-283
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0602
Family HBL-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000071494   Gene: ENSMUSG00000061414   Transcript: ENSMUST00000071563
Sequence length 310
Comment pep:known chromosome:GRCm38:6:127577975:127629938:1 gene:ENSMUSG00000061414 transcript:ENSMUST00000071563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPSGREDSSSQTPGHGKQGSGACVEQLDHPEKLEVEMPDQSAMWKKAQEFFQTCDSEG
KGFIARTDMQRLHQELPLSLEELEDVFDALDADGNGFLTPEEFTTGFSHFFFSQNIQGEE
EADQQVAQLQEEKVYQSRGEEDVGDMDHDEEAQFQMLMDRLGAQKVLEDESDVRQLWLQL
RKDEPHLLSNFEDLLTTIFAQLQEAHEQKNELECALRKKIAAYDEEIQHLYEEMEQQIKS
EREQFLLKDTERFQARSRELEKKLSAKEQELERLNQKQRKVGYCGDIVGPQLFQLSLPLP
HALHHSSMDF
Download sequence
Identical sequences Q3UP38
ENSMUSP00000071494 NP_001028636.1.92730 ENSMUSP00000071494 ENSMUSP00000071494 10090.ENSMUSP00000071494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]