SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000071786 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000071786
Domain Number 1 Region: 31-290
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.44e-92
Family Carbonic anhydrase 0.000000000661
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000071786   Gene: ENSMUSG00000032373   Transcript: ENSMUST00000071889
Sequence length 354
Comment pep:known chromosome:GRCm38:9:66713686:66766845:1 gene:ENSMUSG00000032373 transcript:ENSMUST00000071889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHRSLRATVVLLLVILKKQPSSSAPLNGSKWTYVGPAGEKNWSKKYPSCGGLLQSPIDL
HSDILQYDASLAPLQFQGYNVSVEKLLNLTNDGHSVRLNLNSDMYIQGLQPHHYRAEQLH
LHWGNRNDPHGSEHTVSGKHFAAELHIVHYNSDLYPDFSTASDKSEGLAVLAVLIEIGSA
NPSYDKIFSHLQHVKYKGQQVLIPGFNIEELLPESPGEYYRYEGSLTTPPCYPTVLWTVF
RNPVQISQEQLLALETALYFTHMDDPTPREMINNFRQVQKFDERLVYISFRQGLLTNTGL
SLGIILSVALAGVLGISIVLAVSIWLFKRKKSKKGDNKGVIYKPAIKKEAEVHA
Download sequence
Identical sequences A0A0R4J0W4
ENSMUSP00000071786 ENSMUSP00000071786 NP_848483.3.92730 ENSMUSP00000071786 10090.ENSMUSP00000071786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]