SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000072092 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000072092
Domain Number 1 Region: 2-54
Classification Level Classification E-value
Superfamily LEM domain 7.98e-23
Family LEM domain 0.000057
Further Details:      
 
Domain Number 2 Region: 107-154
Classification Level Classification E-value
Superfamily LEM domain 0.00000000000000366
Family LEM domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000072092   Gene: ENSMUSG00000019961   Transcript: ENSMUST00000072239
Sequence length 452
Comment pep:known chromosome:GRCm38:10:91147571:91171582:-1 gene:ENSMUSG00000019961 transcript:ENSMUST00000072239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLAAGANSK
GPPDFSSDEEREPTPVLGSGASVGRGRGAVGRKATKKTDKPRLEDKDDLDVTELSNEELL
DQLVRYGVNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLPTVSSSAENTRQNGSNDSD
RYSDNDEDSKIELKLEKREPLKGRAKTPVTLKQRRTEHNQSYSQAGVTETEWTSGSSTGG
PLQALTRESTRGSRRTPRKRVETSQHFRIDGAVISESTPIAETIKASSNESLVANRLTGN
FKHASSILPITEFSDITRRTPKKPLTRAEVGEKTEERRVDRDILKEMFPYEASTPTGISA
SCRRPIKGAAGRPLELSDFRMEESFSSKYVPKYAPLADVKSEKTKKRRSVPMWIKMLLFA
LVAVFLFLVYQAMETNQGNPFTNFLQDTKISN
Download sequence
Identical sequences Q61029
NP_001073598.1.92730 ENSMUSP00000072092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]