SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000072509 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000072509
Domain Number 1 Region: 56-260,333-358,395-520,569-593
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.86e-34
Family Quinoprotein alcohol dehydrogenase-like 0.028
Further Details:      
 
Domain Number 2 Region: 1358-1480
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000000814
Family WD40-repeat 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000072509
Domain Number - Region: 999-1336
Classification Level Classification E-value
Superfamily ARM repeat 0.000109
Family GUN4-associated domain 0.081
Further Details:      
 
Domain Number - Region: 12-49
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000651
Family Quinoprotein alcohol dehydrogenase-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000072509   Gene: ENSMUSG00000040560   Transcript: ENSMUST00000072726
Sequence length 1489
Comment pep:known chromosome:GRCm38:18:63708695:63989760:1 gene:ENSMUSG00000040560 transcript:ENSMUST00000072726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGNSLVLPIVLWGRKAPTHCISSILLTDDGGTIVTGCHDGQICLWDVSVELEVNPRALL
FGHTASITCLSKACASGDKRYTVSASANGEMCLWDVNDGRCIEFTKLACTHTGIQFYQFS
VGNQQEGRLLCHGHYPEILVVDATSLEVLYSLVSKISPDWISSMSIIRSQRTQEDTVVAL
SVTGILKVWIVTSEMSGMQDTEPIFEEESKPIYCQNCQSISFCAFTQRSLLVVCSKYWRV
FDAGDYSLLCSGPSENGQTWTGGDFVSADKVIIWTENGQSYIYKLPASCLPASDSFRSDV
GKAVENLIPPVQHSLLDQKDKELVICPPVTRFFYGCKEYLHKLLIQGDSSGRLNIWNIAD
IAEKQEADEGLKMTTCISLQEAFDKLKPCPAGIIDQLSVIPNSNEPLKVTASVYIPAHGR
LVCGREDGSIIIVPATQTAIVQLLQGEHMLRRGWPPHRTLRGHRNKVTCLLYPHQVSARY
DQRYLISGGVDFSVIIWDIFSGEMKHIFCVHGGEITQLLVPPENCSARVQHCICSVASDH
SVGLLSLREKKCIMLASRHLFPIQVIKWRPSDDYLVVGCTDGSVYVWQMDTGALDRCAMG
ITAVEILNACDEAVPAAVDSLSHPAVNLKQAMTRRSLAALKNMAHHKLQTLATNLLASEA
SDKGNLPKYSHNSLMVQAIKTNLTDPDIHVLFFDVEALIIQLLTEEASRPNTALISPENL
QKASGSSDKGGSFLTGKRAAVLFQQVKETIKENIKEHLLDEEEDEEEARRQSREDSDPEY
RASKSKPLTLLEYNLTMDTAKLFMSCLHAWGLNEVLDEVCLDRLGMLKPHCTVSFGLLSR
GGHMSLMLPGYNQAAGKLLHAKAEVGRKLPAAEGVGKGTYTVSRAVTTQHLLSIISLANT
LMSMTNATFIGDHMKKGPTRPPRPGTPDLSKARDSPPPSSNIVQGQIKQAAAPVVSARSD
ADHSGSDSASPALPTCFLVNEGWSQLAAMHCVMLPDLLGLERFRPPLLEMLARRWQDRCL
EVREAAQALLLAELRRIEQAGRKETIDTWAPYLPQYMDHVISPGVTAEAMQTMAAAPDAS
GPEAKVQEEEHDLVDDDITAGCLSSVPQMKKISTSYEERRKQATAIVLLGVIGAEFGAEI
EPPKLLTRPRSSSQIPEGFGLTSGGSNYSLARHTCKALTYLLLQPPSPKLPPHSTIRRTA
TDLIGRGFTVWEPYMDVSAVLMGLLELCADAEKQLANITMGLPLSPAADSARSARHALSL
IATARPPAFITTIAKEVHRHTALAANTQSQQSIHTTTLARAKGEILRVIEILIEKMPTDV
VDLLVEVMDIIMYCLEGSLVKKKGLQECFPAICRFYMVSYYERSHRIAVGARHGSVALYD
IRTGKCQTIHGHKGPITAVSFAPDGRYLATYSNTDSHISFWQMNTSLLGSIGMLNSAPQL
RCIKTYQVPPVQPASPGSHNALKLARLIWTSNRNVILMAHDGKEHRFMV
Download sequence
Identical sequences Q920I9
ENSMUSP00000072509 NP_001014981.1.92730 ENSMUSP00000072509 10090.ENSMUSP00000072509 ENSMUSP00000072509 NYSGXRC-13161a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]