SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000073860 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000073860
Domain Number - Region: 3-54,283-305
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0314
Family Voltage-gated potassium channels 0.01
Further Details:      
 
Domain Number - Region: 148-193
Classification Level Classification E-value
Superfamily EF-hand 0.0326
Family S100 proteins 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000073860   Gene: ENSMUSG00000036186   Transcript: ENSMUST00000074240
Sequence length 431
Comment pep:known chromosome:GRCm38:2:26628457:26636497:1 gene:ENSMUSG00000036186 transcript:ENSMUST00000074240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRLRRLVHLVLLCPFSKGLQGRLPGLRVKYVLLVWLGIFVGSWMVYVHYSSYSELCRGH
VCQVVICDQYRKGIISGSVCQDLCELQKVEWRTCLSSAPGQQVYSGLWQDKEVTIKCGIE
EALNSKAWPDAAPRRELVLFDKPTRGTSIKEFREMTLSFLKANLGDLPSLPALVDQILLM
ADFNKDSRVSLAEAKSVWALLQRNEFLLLLSLQEKEHASRLLGYCGDLYLTEGIPHGSWH
GAVLLPALRPLLPSVLHRALQQWFGPAWPWRAKIAIGLLEFVEELFHGSYGTFYMCETTL
ANVGYTATYDFKMADLQQVAPEATVRRFLQGRHCEQSSDCIYGRDCRAPCDRLMRQCKGD
LIQPNLAKVCELLRDYLLPGAPAGLYEELGKQLRTCTTLSGLASQIEAHHSLVLSHLKTL
LWREISNTNYS
Download sequence
Identical sequences Q99ML4
ENSMUSP00000073860 NP_062807.2.92730 ENSMUSP00000073860 10090.ENSMUSP00000073860 ENSMUSP00000073860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]