SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000074935 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000074935
Domain Number 1 Region: 216-343
Classification Level Classification E-value
Superfamily TPR-like 1.99e-24
Family Tetratricopeptide repeat (TPR) 0.0014
Further Details:      
 
Domain Number 2 Region: 84-213
Classification Level Classification E-value
Superfamily FKBP-like 5.89e-23
Family FKBP immunophilin/proline isomerase 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000074935   Gene: ENSMUSG00000019428   Transcript: ENSMUST00000075491
Sequence length 403
Comment pep:novel chromosome:GRCm38:8:70527747:70535326:1 gene:ENSMUSG00000019428 transcript:ENSMUST00000075491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASWAEPSEPAALRLPGAPLLEGFEVLDGVDDAEEEDDLSGLPPLEDMGQPTVEEAEQPG
ALAREFLAATEPEPAPAPAPEEWLDILGNGLLRMKTLVPGPKGSSRPLKGQVVTVHLQMS
LENGTRVQEEPELAFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYIP
PHAALCLEVTLKTAEDGPDLEMLSGQERVALANRKRECGNAHYQRADFVLAANSYDLAIK
AITSNTKVDMTCEEEEELLQLKVKCLNNLAASQLKLDHYRAALRSCSQVLEHQPDNIKAL
FRKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKRAAQRSTETALYRKMLG
NPSRLPAKCPGKGAWSIPWKWLFGATAVALGGVALSVVIAARN
Download sequence
Identical sequences ENSMUSP00000074935 ENSMUSP00000112527 NP_001104536.1.92730 NP_001186560.1.92730 XP_006509619.1.92730 10090.ENSMUSP00000114069 ENSMUSP00000074935 ENSMUSP00000114069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]