SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000077196 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000077196
Domain Number 1 Region: 418-594
Classification Level Classification E-value
Superfamily p53-like transcription factors 5.9e-76
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000193
Further Details:      
 
Domain Number 2 Region: 595-720
Classification Level Classification E-value
Superfamily E set domains 6.12e-32
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.000049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000077196   Gene: ENSMUSG00000033016   Transcript: ENSMUST00000078049
Sequence length 827
Comment pep:known chromosome:GRCm38:18:80606205:80713071:-1 gene:ENSMUSG00000033016 transcript:ENSMUST00000078049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSTSFPVPSKFPLGPPAAVCGSGETLRPAPPSGGTMKAAEEEHYSYVSPSVTSTLPLPT
AHSALPAACHDLQTSTPGISAVPSANHPPSYGGAVDSGPSGYFLSSGNTRPNGAPTLESP
RIEITSYLGLHHGSGQFFHDVEVEDVLPSCKRSPSTATLHLPSLEAYRDPSCLSPASSLS
SRSCNSEASSYESNYSYPYASPQTSPWQSPCVSPKTTDPEEGFPRSLGACHLLGSPRHSP
STSPRASITEESWLGARGSRPTSPCNKRKYSLNGRQPSCSPHHSPTPSPHGSPRVSVTED
TWLGNTTQYTSSAIVAAINALTTDSTLDLGDGVPIKSRKTALEHAPSVALKVEPAGEDLG
TTPPTSDFPPEEYTFQHLRKGAFCEQYLSVPQASYQWAKPKSLSPTSYMSPSLPALDWQL
PSHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLENEPLTLQLFIG
TADDRLLRPHAFYQVHRITGKTVSTTSHEIILSNTKVLEIPLLPENNMRAIIDCAGILKL
RNSDIELRKGETDIGRKNTRVRLVFRVHIPQPNGRTLSLQVASNPIECSQRSAQELPLVE
KQSTDSYPVIGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCKPNSLVVE
IPPFRNQRITSPVQVSFYVCNGKRKRSQYQRFTYLPANVPIIKTEPTDDFEPALTCGPMS
QGISPLPRPYYSQQLTMPPDPGSCLVAGFAPCSQRNTLMPTPPNASPKLHDLSSPAYTKG
LTNPGHSGHLGLQPPASEAPTMQEVPRPMAIQPNSPEQPPSARLQPQ
Download sequence
Identical sequences Q6P7T9
ENSMUSP00000077196 10090.ENSMUSP00000077196 NP_940821.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]