SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000077402 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000077402
Domain Number 1 Region: 292-549
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.64e-77
Family Eukaryotic proteases 0.00014
Further Details:      
 
Domain Number 2 Region: 168-280
Classification Level Classification E-value
Superfamily Kringle-like 6.04e-33
Family Kringle modules 0.00034
Further Details:      
 
Domain Number 3 Region: 67-109
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000469
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 107-144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000168
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000077402   Gene: ENSMUSG00000025075   Transcript: ENSMUST00000078284
Sequence length 554
Comment pep:known chromosome:GRCm38:19:56287137:56320089:1 gene:ENSMUSG00000025075 transcript:ENSMUST00000078284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVFRVLLLIALVGKSVIGLSLMSFIAPPDPDWTPDDYYYSYEQSSPDEDPSVTQTTPEN
PDWYYEDDDPCQSNPCEHGGDCIIRGDTFSCSCPAPFSGSRCQTAQNKCKDNPCVHGDCL
ITQKHPYYRCACKYPYTGPDCSKVLPACRPNPCQNGGVCSRHRRRSRFTCACPDQYKGKF
CEIGPDDCYVGDGYSYRGKVSKTVNQNPCLYWNSHLLLQETYNMFMEDAETHGIAEHNFC
RNPDGDHKPWCFVKVNSEKVKWEYCDVTVCPVPDTPNPVESLLEPVMELPGFESCGKTEV
AEHAVKRIYGGFKSTAGKHPWQVSLQTSLPLTTSMPQGHFCGGALIHPCWVLTAAHCTDI
NTKHLKVVLGDQDLKKTESHEQTFRVEKILKYSQYNERDEIPHNDIALLKLKPVGGHCAL
ESRYVKTVCLPSDPFPSGTECHISGWGVTETGEGSRQLLDAKVKLIANPLCNSRQLYDHT
IDDSMICAGNLQKPGSDTCQGDSGGPLTCEKDGTYYVYGIVSWGQECGKKPGVYTQVTKF
LNWIKTTMHREAGL
Download sequence
Identical sequences E9QM92
ENSMUSP00000077402 ENSMUSP00000126235 XP_006527077.1.92730 ENSMUSP00000077402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]