SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000077563 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000077563
Domain Number 1 Region: 508-694
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.62e-42
Family cAMP-binding domain 0.002
Further Details:      
 
Domain Number 2 Region: 216-318,350-404,443-505
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.55e-42
Family Voltage-gated potassium channels 0.0023
Further Details:      
 
Domain Number 3 Region: 39-135
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.79e-19
Family Flavin-binding PAS domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000077563   Gene: ENSMUSG00000058248   Transcript: ENSMUST00000078470
Sequence length 989
Comment pep:known chromosome:GRCm38:1:192190784:192510159:1 gene:ENSMUSG00000058248 transcript:ENSMUST00000078470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMAGGRRGLVAPQNTFLENIVRRSNDTNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEV
MQKSSACSFMYGELTDKDTVEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQ
DKVVLFLCTFSDITAFKQPIEDDSCKGWGKFARLTRALTSSRGVLQQLAPSVQKGENVHK
HSRLAEVLQLGSDILPQYKQEAPKTPPHIILHYCVFKTTWDWIILILTFYTAILVPYNVS
FKTRQNNVAWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYLKTWFVIDL
LSCLPYDVINAFENVDEVSAFMGDPGKIGFADQIPPPLEGRESQGISSLFSSLKVVRLLR
LGRVARKLDHYIEYGAAVLVLLVCVFGLAAHWMACIWYSIGDYEIFDEDTKTIRNNSWLY
QLALDIGTPYQFNGSGSGKWEGGPSKNSVYISSLYFTMTSLTSVGFGNIAPSTDIEKIFA
VAIMMIGSLLYATIFGNVTTIFQQMYANTNRYHEMLNSVRDFLKLYQVPKGLSERVMDYI
VSTWSMSRGIDTEKVLQICPKDMRADICVHLNRKVFKEHPAFRLASDGCLRALAMEFQTV
HCAPGDLIYHAGESVDSLCFVVSGSLEVIQDDEVVAILGKGDVFGDVFWKEATLAQSCAN
VRALTYCDLHVIKRDALQKVLEFYTAFSHSFSRNLILTYNLRKRIVFRKISDVKREEEER
MKRKNEAPLILPPDHPVRRLFQRFRQQKEARLAAERGGRDLDDLDVEKGNALTDHTSANH
SLVKASVVTVRESPATPVSFQAATTSTMSDHAKLHAPGSECLGPKAVSCDPAKRKGWARF
KDACGKGEDWNKVSKAESMETLPERTKAPGEATLKKTDSCDSGITKSDLRLDNVGETRSP
QDRSPILAEVKHSFYPIPEQTLQATVLEVKYELKEDIKALNAKMTSIEKQLSEILRILMS
RGSAQSPQETGEISRPQSPESDRDIFGAS
Download sequence
Identical sequences A0A1L1M1J8
NP_034730.1.92730 ENSMUSP00000077563 ENSMUSP00000077563 10090.ENSMUSP00000077563 ENSMUSP00000077563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]