SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000078369 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000078369
Domain Number 1 Region: 7-363
Classification Level Classification E-value
Superfamily Glutaminase/Asparaginase 1.83e-98
Family Glutaminase/Asparaginase 0.0000000932
Further Details:      
 
Domain Number 2 Region: 404-554
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.91e-30
Family Ankyrin repeat 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000078369   Gene: ENSMUSG00000037686   Transcript: ENSMUST00000079400
Sequence length 564
Comment pep:known chromosome:GRCm38:12:112106683:112127573:1 gene:ENSMUSG00000037686 transcript:ENSMUST00000079400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARAMGPERRLLAIYTGGTIGMRSEGGVLVPGRGLAAVLKTLHMFHDEEYAQAHSLPEDT
LVLPPASPDQRIIYTVLECQPLFDSSDMTITEWVQIAQTIERHYAQYQGFVVIHGTDTMA
FAASVLSFMLENLQKPVVLTGAQVPIHALWSDGRENLLGALLMAGQYVIPEVCLFFQNQL
FRGNRTTKVDARRFAAFCSPNLPPLATVGADVTINRELVRKACGKSHLVVHSSMEPDVGL
LRLYPGIPASLVRTFLQPPLKGVVMETFGSGNGPTKPDLLQELRVAAEQGLIIVNCTHCL
QGAVTSDYASGMAMAGAGIVSGFDMTSEAALAKLSYVLGQPGLSLNDRKKLLAKDLRGEM
TLPATDVLLQDGMLGCRVAWLLSMNGSQEADTMKDVLLPGLALAAAHAGDLDTLQAFVEL
DRDLNLKDYSGQTPLHVAARRGHAAVVTMLLQRGADVDARNEDGQSPLLLAVRGRHQSVI
GLLRAAGARLSPQELEDVGTELCRLASRGDSEGLRAWWQAGADLGQPDYDGHCALQVAEA
AGNADVVALLQSFKDSVCAQPQPH
Download sequence
Identical sequences A0JNU3
ENSMUSP00000078369 ENSMUSP00000078369 NP_001074638.1.92730 ENSMUSP00000078369 10090.ENSMUSP00000078369

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]