SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000078382 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000078382
Domain Number 1 Region: 27-140
Classification Level Classification E-value
Superfamily FKBP-like 2.16e-39
Family FKBP immunophilin/proline isomerase 0.00000202
Further Details:      
 
Domain Number 2 Region: 256-415
Classification Level Classification E-value
Superfamily TPR-like 2.04e-33
Family Tetratricopeptide repeat (TPR) 0.0000000878
Further Details:      
 
Domain Number 3 Region: 142-253
Classification Level Classification E-value
Superfamily FKBP-like 2.55e-26
Family FKBP immunophilin/proline isomerase 0.00000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000078382   Gene: ENSMUSG00000024222   Transcript: ENSMUST00000079413
Sequence length 456
Comment pep:known chromosome:GRCm38:17:28399095:28486149:-1 gene:ENSMUSG00000024222 transcript:ENSMUST00000079413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTDEGTSNNGENPAATMTEQGEDITTKKDRGVLKIVKRVGTSDEAPMFGDKVYVHYKGM
LSDGKKFDSSHDRKKPFAFSLGQGQVIKAWDIGVSTMKKGEICHLLCKPEYAYGSAGHLQ
KIPSNATLFFEIELLDFKGEDLFEDSGVIRRIKRKGEGYSNPNEGATVKVHLEGCCGGRT
FDCRDVVFVVGEGEDHDIPIGIDKALVKMQREEQCILYLGPRYGFGEAGKPKFGIDPNAE
LMYEVTLKSFEKAKESWEMDTKEKLTQAAIVKEKGTVYFKGGKYTQAVIQYRKIVSWLEM
EYGLSEKESKASESFLLAAFLNLAMCYLKLREYNKAVECCDKALGLDSANEKGLYRRGEA
QLLMNDFESAKGDFEKVLAVNPQNRAARLQISMCQRKAKEHNERDRRVYANMFKKFAERD
AKEEASKAGSKKAVEGAAGKQHESQAMEEGKAKGHV
Download sequence
Identical sequences Q4FJN2 Q64378
ENSMUSP00000078382 ENSMUSP00000110440 ENSMUSP00000136245 ENSMUSP00000078382 399931 NP_034350.1.92730 ENSMUSP00000078382 10090.ENSMUSP00000110440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]