SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000079373 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000079373
Domain Number 1 Region: 309-409
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.93e-24
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0011
Further Details:      
 
Domain Number 2 Region: 46-116
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 8.51e-16
Family HLH, helix-loop-helix DNA-binding domain 0.002
Further Details:      
 
Domain Number 3 Region: 132-227
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000433
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000079373   Gene: ENSMUSG00000040187   Transcript: ENSMUST00000080530
Sequence length 579
Comment pep:known chromosome:GRCm38:6:146805530:146832646:1 gene:ENSMUSG00000040187 transcript:ENSMUST00000080530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFPRKRRGRDSQPLQSEFMTDTTVESLPQNPFASLLSTRTGVSAPSGIREAHSQMEKRR
RDKMNHLIQKLSSMIPPHIPTAHKLDKLSVLRRAVQYLRSLRGMTELYLGENSKPSFIQD
KELSHLILKAAEGFLFVVGCERGRIFYVSKSVSKTLRYDQASLIGQNLFDFLHPKDVAKV
KEQLSCDGSPREKPIDTKTSQVYSHPYTGRPRMHSGSRRSFFFRMKSCTVPVKEEQPCSS
CSKKKDHRKFHTVHCTGYLRSWPLNVVGMEKESGGGKDSGPLTCLVAMGRLHPYIVPQKS
GKINVRPAEFITRFAMNGKFVYVDQRATAILGYLPQELLGTSCYEYFHQDDHSSLTDKHK
AVLQSKEKILTDSYKFRVKDGAFVTLKSEWFSFTNPWTKELEYIVSVNTLVLGRSETRLS
LLHCGGSSQSSEDSFRQSCINVPGVSTGTVLGAGSIGTDIANEVLSLQRLHSSSPEDASP
SEEVRDDCSVNGGNAYGPASTREPFAVSPSETEVLEAARQHQSTEPAHPHGPLPGDSAQL
GFDVLCDSDSIDMAAFMNYLEAEGGLGDPGDFSDIQWAL
Download sequence
Identical sequences Q2VPD4
NP_758513.1.92730 XP_006507116.1.92730 ENSMUSP00000079373 ENSMUSP00000107266 ENSMUSP00000079373 ENSMUSP00000079373 10090.ENSMUSP00000107266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]