SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000080767 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000080767
Domain Number 1 Region: 61-195
Classification Level Classification E-value
Superfamily dUTPase-like 1.7e-48
Family dUTPase-like 0.000000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000080767   Gene: ENSMUSG00000027203   Transcript: ENSMUST00000082122
Sequence length 200
Comment pep:known chromosome:GRCm38:2:125247190:125257748:1 gene:ENSMUSG00000027203 transcript:ENSMUST00000082122 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLSVLLRARLQAALLRGRALGSARSRSCRGSRGAPAGSARADAAAVSASKRARAEDGA
SLRFVRLSEHATAPTRGSARAAGYDLFSAYDYTISPMEKAIVKTDIQIAVPSGCYGRVAP
RSGLAVKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERISYPDLEE
VQTLDDTERGSGGFGSTGKN
Download sequence
Identical sequences Q8VCG1
ENSMUSP00000057854 10090.ENSMUSP00000080767 ENSMUSP00000080767 NP_001153118.1.92730 ENSMUSP00000080767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]