SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000082154 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000082154
Domain Number 1 Region: 336-438
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6e-28
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.003
Further Details:      
 
Domain Number 2 Region: 65-148
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000262
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 3 Region: 147-201,228-243,271-283
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000154
Family BphP N-terminal domain-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000082154   Gene: ENSMUSG00000015709   Transcript: ENSMUST00000085077
Sequence length 712
Comment pep:known chromosome:GRCm38:7:84246281:84409959:-1 gene:ENSMUSG00000015709 transcript:ENSMUST00000085077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPAAVNPPEMASDIPGSVALPVAPMAATGQVRMAGAMPARGGKRRSGMDFDDEDGEGP
SKFSRENHSEIERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMKSMRGTG
NKSTDGAYKPSFLTEQELKHLILEAADGFLFVVAAETGRVIYVSDSVTPVLNQPQSEWFG
STLYEQVHPDDVEKLREQLCTSENSMTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICR
MRCGNAPLDHLPLNRITTMRKRFRNGLGPVKEGEAQYAVVHCTGYIKAWPPAGMTIPEED
ADVGQGSKYCLVAIGRLQVTSSPVCMDMSGMSVPTEFLSRHNSDGIITFVDPRCISVIGY
QPQDLLGKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWLLIRTSSFTF
QNPYSDEIEYVICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPAGVHEAGKSV
EKADAIFSQERDPRFAEMFAGISASEKKMMSSASASGSQQIYSQGSPFPAGHSGKAFSSS
VVHVPGVNDIQSSSSTGQNISQISRQLNQGQVAWTGSRPPFPGQPSKTQSSAFGIGSSHP
YPADPSSYSPLSSPAASSPSGNAYPSLANRTPGFAESGQSGGQFQGRPSEVWSQWQSQHH
GQQSGEQHSHQQPGQTEVFQDMLPMPGDPTQGTGNYNIEDFADLGMFPPFSE
Download sequence
Identical sequences Q61324
NP_031514.3.92730 ENSMUSP00000082154 ENSMUSP00000082154 ENSMUSP00000082154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]