SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000082288 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000082288
Domain Number 1 Region: 28-518
Classification Level Classification E-value
Superfamily ALDH-like 1.96e-144
Family ALDH-like 0.000000476
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000082288   Gene: ENSMUSG00000021238   Transcript: ENSMUST00000085192
Sequence length 535
Comment pep:known chromosome:GRCm38:12:84430723:84450950:-1 gene:ENSMUSG00000021238 transcript:ENSMUST00000085192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVAAAAAMRSRILQVSSKVNATWYPASSFSSSSVPTVKLFIDGKFVESKSDKWIDIH
NPATNEVVGRVPQSTKAEMDAAVESCKRAFPAWADTSILSRQQVLLRYQQLIKENLKEIA
RLITLEQGKTLADAEGDVFRGLQVVEHACSVTSLMLGETMPSITKDMDLYSYRLPLGVCA
GIAPFNFPAMIPLWMFPMAMVCGNTFLMKPSERVPGATMLLAKLLQDSGAPDGTLNIIHG
QHDAVNFICDHPDIKAISFVGSNQAGEYIFERGSRNGKRVQANMGAKNHGVVMPDANKEN
TLNQLVGAAFGAAGQRCMALSTAILVGEAKKWLPELVDRAKNLRVNAGDQPGADLGPLIT
PQAKERVCNLIDSGTKEGASILLDGRRIKVKGYENGNFVGPTIISNVKPSMTCYKEEIFG
PVLVVLETETLDEAIKIVNDNPYGNGTAIFTTNGATARKYAHMVDVGQVGVNVPIPVPLP
MFSFTGSRSSFRGDTNFYGKQGIQFYTQLKTITSQWKEEDATLSSPAVVMPTMGR
Download sequence
Identical sequences Q9EQ20
NP_598803.1.92730 10090.ENSMUSP00000082288 ENSMUSP00000082288 ENSMUSP00000082288 ENSMUSP00000082288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]