SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000082906 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000082906
Domain Number 1 Region: 36-151
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000126
Family Voltage-gated potassium channels 0.025
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000082906
Domain Number - Region: 167-206
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.0693
Family C-terminal domain of PLC-beta 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000082906   Gene: ENSMUSG00000032313   Transcript: ENSMUST00000085754
Sequence length 298
Comment pep:known chromosome:GRCm38:9:55326913:55438345:1 gene:ENSMUSG00000032313 transcript:ENSMUST00000085754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLFQPHRAFRSDWLKPCCGKRAAVWQVFLLSASLNSFLVACVILVVILLTLELLIDTKL
LQFSNAFQFAGVIHWISLVILSVFFSETVLRIVVLGIWDYIENKIEVFDGAVIILSLAPM
VASTVANGPRSPWDAISLIIMFRIWRVKRVIDAYVLPVKLEMEMVTQQYEKAKAIQDEQL
ERLTQICQEQGFEIRQLRAHLAQQDLDLAAEREAALQAPHVLSQPRSRYKVVEAGTWAEE
TAAESIVEELRPSQEATVKDDMNSYISQYYNGPSSGKSGLGLFACTMQPQDTCDPSKP
Download sequence
Identical sequences XP_011241048.1.92730 ENSMUSP00000082906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]