SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000083878 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000083878
Domain Number 1 Region: 67-118
Classification Level Classification E-value
Superfamily LEM domain 0.00000000000844
Family LEM domain 0.0035
Further Details:      
 
Domain Number 2 Region: 321-384,412-457
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000174
Family Ankyrin repeat 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000083878   Gene: ENSMUSG00000029501   Transcript: ENSMUST00000086674
Sequence length 886
Comment pep:known chromosome:GRCm38:5:110231004:110256651:1 gene:ENSMUSG00000029501 transcript:ENSMUST00000086674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWQRLAVVEWAALAWELLGASVLFIAVRWLVRRLEKRPRDLNRCGTLSSPPSASEAVAA
QPGEVTMDAMMARLKLLNPDDLRKEVMKAGLKCGPITSTTRFIFEKKLAQALLEQGGLLT
SSLPKPSAVTAMAFIQGTSRTPPSVDGKQTQQACFSEDRDFGYSVGLNPPEEEAVASSVH
PVPFSASTRNDNHKAGVTAPKEPLVYYGVCPVYEDGPVRHERIHVYEDKKEALQAAKLIK
GSRFKAFRTREDAEKFARGICDYLPSPNKTTPLLSPVKAVPLGGSDGLKADGLCLAESET
VNKERANSYKNPRTQDLTAKLRKAVENGEEHTFSDLIWSNPRYLIGSGDNPTIVQEGCRY
NVMHVAAKENQASMCQLTLETLENPEFMRLMYPDDNMDMLQKRILYVVDLYLNTPDKVGF
DTPLHFACKFGNVDVVNVLSSHPLIVKNRKNKYGKTPEEVICERSQNKSPALKERIREYL
MGHYYVPLLRAEDTSPVIGELWSSDQKAEASNTAHCRSSPRDPVMTLRAFVGPLSPSKAE
DFRKLWKTPPRKKAGFFHSIRKSDPERGIERVGRELAHELGYPWVEYWEFLGCFVDLSSQ
EGLQRLEEYLIQKELSKKAQQEIRENEGCLQDRTSDFGSGKKYSNSISVGAFLDGDDDSS
LEEIKNTQELNKLNLQSLGDSLHETPDKNGKLEDEVLPSRKGAADSDLLASPPAIASLGK
KQVRTNTEVSEAMAEMSLGPKSPQLGVQAGLEPILSSATVDSTKRLFLSGEEPSKLDRDV
LAALECANIDPGLYPAIHRWKSTVMCYSPSDRQSWPSPALKGKFTTELVDLDCSHSCSGR
CSPAGSSPSKPGHTSSSSGLHSPGRYSPAHGRHFQRVAHVARLAAL
Download sequence
Identical sequences ENSMUSP00000083878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]