SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000083928 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000083928
Domain Number 1 Region: 621-1147
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 9.57e-151
Family alpha-mannosidase, C-terminal domain 0.00000103
Further Details:      
 
Domain Number 2 Region: 122-498
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 4.2e-140
Family alpha-mannosidase 0.00000000152
Further Details:      
 
Domain Number 3 Region: 501-613
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 2.55e-30
Family alpha-mannosidase, domain 2 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000083928   Gene: ENSMUSG00000024085   Transcript: ENSMUST00000086723
Sequence length 1150
Comment pep:known chromosome:GRCm38:17:64600736:64755110:1 gene:ENSMUSG00000024085 transcript:ENSMUST00000086723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLSRQFTVFGSAIFCVVIFSLYLMLDRGHLDYPRGPRQEGSFPQGQLSILQEKIDHLER
LLAENNEIISNIRDSVINLSESVEDGPRGSPGNASQGSIHLHSPQLALQADPRDCLFASQ
SGSQPRDVQMLDVYDLIPFDNPDGGVWKQGFDIKYEADEWDHEPLQVFVVPHSHNDPGWL
KTFNDYFRDKTQYIFNNMVLKLKEDSSRKFMWSEISYLAKWWDIIDIPKKEAVKSLLQNG
QLEIVTGGWVMPDEATPHYFALIDQLIEGHQWLEKNLGVKPRSGWAIDPFGHSPTMAYLL
KRAGFSHMLIQRVHYAIKKHFSLHKTLEFFWRQNWDLGSATDILCHMMPFYSYDIPHTCG
PDPKICCQFDFKRLPGGRYGCPWGVPPEAISPGNVQSRAQMLLDQYRKKSKLFRTKVLLA
PLGDDFRFSEYTEWDLQCRNYEQLFSYMNSQPHLKVKIQFGTLSDYFDALEKAVAAEKKS
SQSVFPALSGDFFTYADRDDHYWSGYFTSRPFYKRMDRIMESRIRAAEILYQLALKQAQK
YKINKFLSSPHYTTLTEARRNLGLFQHHDAITGTAKDWVVVDYGTRLFQSLNSLEKIIGD
SAFLLILKDKKLYQSDPSKAFLEMDTKQSSQDSLPQKIIIQLSAQEPRYLVVYNPFEQER
HSVVSIRVNSATVKVLSDSGKPVEVQVSAVWNDMRTISQAAYEVSFLAHIPPLGLKVFKI
LESQSSSSHLADYVLYNNDGLAENGIFHVKNMVDAGDAITIENPFLAIWFDRSGLMEKVR
RKEDSRQHELKVQFLWYGTTNKRDKSGAYLFLPDGQGQPYVSLRPPFVRVTRGRIYSDVT
CFLEHVTHKVRLYNIQGIEGQSMEVSNIVNIRNVHNREIVMRISSKINNQNRYYTDLNGY
QIQPRRTMSKLPLQANVYPMCTMAYIQDAEHRLTLLSAQSLGASSMASGQIEVFMDRRLM
QDDNRGLGQGVHDNKITANLFRILLEKRSAVNMEEEKKSPVSYPSLLSHMTSSFLNHPFL
PMVLSGQLPSPAFELLSEFPLLQSSLPCDIHLVNLRTIQSKMGKGYSDEAALILHRKGFD
CQFSSRGIGLPCSTTQGKMSVLKLFNKFAVESLVPSSLSLMHSPPDAQNMSEVSLSPMEI
STFRIRLRWT
Download sequence
Identical sequences P27046
ENSMUSP00000083928 10090.ENSMUSP00000083928 ENSMUSP00000083928 NP_032575.2.92730 ENSMUSP00000083928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]