SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000088670 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000088670
Domain Number 1 Region: 1756-1870
Classification Level Classification E-value
Superfamily CalX-like 3.66e-23
Family CalX-beta domain 0.001
Further Details:      
 
Domain Number 2 Region: 1870-2002
Classification Level Classification E-value
Superfamily CalX-like 1.44e-22
Family CalX-beta domain 0.0012
Further Details:      
 
Domain Number 3 Region: 2115-2236
Classification Level Classification E-value
Superfamily CalX-like 4.97e-21
Family CalX-beta domain 0.0015
Further Details:      
 
Domain Number 4 Region: 2238-2351
Classification Level Classification E-value
Superfamily CalX-like 7.72e-21
Family CalX-beta domain 0.0012
Further Details:      
 
Domain Number 5 Region: 1996-2113
Classification Level Classification E-value
Superfamily CalX-like 6.93e-20
Family CalX-beta domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000088670   Gene: ENSMUSG00000037016   Transcript: ENSMUST00000091137
Sequence length 3160
Comment pep:known chromosome:GRCm38:3:53513939:53657355:-1 gene:ENSMUSG00000037016 transcript:ENSMUST00000091137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRARRTAKFSSFQPILAQSPRLLLLLLLLSLVSYVSTQAAGPGAALQSLGLSGTSGVP
TEEAIVVANRGLRVPFGREVWLDPLRDLVLQVQPGDRCTVTVLDNDALAQRPGHLSPKRF
ACDYGPGEVRYSHLGARSPSRDRVRLQLRYDAPGGAIVLPLALEVEVVFTQLEIVTRNLP
LVVEELLGTSNALDDRSLEFAYQPETEECRVGILSGLSALPRYGELLHYPQVQGGAGDRG
TSKTLLMDCKAFQELGVRYRHTAPSRSPNRDWLPMVVELHSRGAPEGSPALKREHFQVLV
RIRGGAENTAPKPSFVAMMMMEVDQFVLTALTPDMLAAEDAESDPDLLIFNLTSAFQPGQ
GYLVSTDDRSLPLSSFTQRDLRLLKIAYQPPSEDSDQERLFELELEIVDPEGAASDPFAF
MVVVKPMNTLAPVVTRNTGLILYEGQYRPLTGPIGSGPQNLVISDEDDLEAVRLEVVAGL
RHGHLVILGSPSSDSAPKTFTVAELAAGQVVYQHDDKDGSLSDNLVLRMSDGGGRHQVQF
LFPITLVPVDDQPPVLNANTGLTVAEGETVPIPPLTLSATDIDSDDSQLVFVLLPPFSSL
GHLLLRQRHVPQEEQGLWQKQGSFYERTVTEWRQQDITEGKLFYRHSGPHSPGPVMDQFM
FRVQDNHDPPNQSGIQRFVIRIHPVDRLPPELGSGCPLRMVVQESQLTPLRKRWLHYTDL
DTDDRELQYTVTQPPTDTDENHSPAPLGTLVFTDNPSVVVSHFTQAQVNHHKIAYRPPGQ
ELGVAARVAQFQFQVEDRAGNVAPGTFTLYLQPVDNQPPEIVNTGFTVEEKGHHILRETE
LHVSDVDTDVTHISFTLTQAPKHGHMQISGRPLHVGGQFHLEDIKHGRISYWNSGDESLT
DSCSLEVSDRHHVVPITLRVNVRPGDREGPMSVLPAGTLESYLDVLENGATEVTANIIKG
AYQGTDDLMLTFLLEGPPSYGEILVNGAPAEQFTQRDILEGSVVYAHTSGEIGLLPKADS
FNLSLSAMSQEWRIGSSIVQGVTVWVTILPVDSQAPEISLGEQFVVLEGDKSVISLTHLS
AEDMDSLKDDLLCTIVIQPTSGYVENISPAPGSEKSRAGVAISAFTLKDLRQGHINYVQS
VHRGVEPVEDRFIFRCSDGINFSERQIFPIVIIPTNDEQPEMFMREFMVMEGMSLVVNRL
ILNAADADIPRDDLTFTITRFPTHGHVMNQLINGTVLVESFTLDQIIESSSIIYEHDDSE
TQEDSFVIKLTDGKHSVEKMVLIVVIPVDDETPRMTINNGLEIEIGETKVINNKVLMATD
LDSDDKSLVYIIRYGPGHGLLQRQKPLGAFENITLGMNFTQDEVDRNLIQYVHFGQEGIR
DLIKFDVTDGTNALIDRYFYVTIGSVDIVFPDVVSKGVSLKEGGKVTLTTDLLSTSDLNS
PDENLVFTITRAPMRGHLECTDRRGLSITSFTQLQLAGNKIYYIHTAEDEVKMDSFEFQV
TDGRNPVFRTFRISISDVDNKKPVVTIHNLVVSESESKLITPFELTVEDRDTPDRLLKFI
VTQVPVHGHLLFNNTRSVMVFTKQDLNENLISYKHDGTESTEDSFSFTVTDGTHSDFYVF
PDTVFETRRPQVMKIQVLPVDNSVPQIVVNKGASTLRTLATGHLGFMITSKILKVEDRDS
LHFSLRFIVTEAPQHGYLLNLGQGNHSVTQFTQADIDDMKICYVLRERANATSDMFHFIV
EDDGGNRLTNQHFRLNWAWISFEKEYYLINEDSKFLDIVLTRRGYLGETSFISIGTRDGT
AEKDRDFKGKAQKQVQFNPGQTRASWRVRILSDGEHEHSETFQVVLSEPVLAILEFPTVT
TVEIIDPGDESTVFIPQSEYSVEEDVGELFIPIRRSGDISRELMVICYTQQGTATSTVRT
SVLSYSDYISRPEDHSSVIRFDKDEREKMCRILVIDDSLYEEEETFQVLLSMPMGGRIGD
KFPGANVTILTDRDDEPAFYFGDTQYSVDESAGYVELQVWRTGTDLSKPSSVTVRSRKTE
SLSADAGTDYVGISRNLDFAPGVNMQTVRVVILDDLGRPILEGIEKFELVLRMPMNAALG
EPSKATVSINDSASDLPKMQFKERVYTCNENDGRVVAMIYRSGDIQHRSSVRCYTRQGSA
QVMMDFEERPNTDVSTVTFLPGEMEKPCVLELMDDAVYEDVEELRLVLGTPQGSSAFGAA
VGEQNETLIKIQDEADKAVIKFGETKFSVTEPSRPGESVVVKIPVIRQGDTSKVSIVRVH
TKDGSATSGEDYHPVSEEIEFKEGETQHTVEIEVIFDGVREMREAFTVHLKPDENMVAET
QATKAIVYIEEIHSMADVTFPSVPHIVSLLIYDDPSKGREDTGPVSGYPVVCITACNPKY
PDYEKTGSICASENINDTLTRYRWLISAPAGPDGVTSPMREVDFDTFFTSSKMITLDSIY
FQPGSRVQCAARAVNTNGNEGLELMSPIVTIGREEGLCQPRVPGVVGAEPFSAKLRYTGP
EDPDFANLIKLTVTMPHIDGMLPAISTRELSNFELTLSPDGTRVGNHKCSNLLDYNEVKT
HHGFLTNATKNPEVIGETYPYQYSVPVRGSSTLRFYRNLNLEACLWEFVSYYDMTELLAD
CGGTIGTDGQVLNLVQSYVTLRVPLYVSYVFHSPVGVGGWQHFDLKSELRLTFVYDTAIL
WNHGIGSPPEAELQGSLYPTSMRIGEEGRLAVNFKTEAQFHGLFVLSHPASFTSSLIVSA
DHPGLTFSLRLIRSEPTYNQPVQQWSFVSDFAVRDYSGTYTVKLVPCTTPSNQEYRLPVT
CNPREPVTFDLDIRFQQVSDPVATEFSLNTHMYLLSKKNLWLSDGSMGFGQESDVAFAEG
DVIYGRVMVDPVQNLGDSFYCSIEKVFLCTGDDGYVPKYSPANAEYGCLADSPSLLHRFK
IVDKAQPETQATSFGDVLFNAKLAVDDPEAVLLVNQPGSDGFKVDSTPLFQVALGREWYI
HTIYTVKSKDNTHRGIGKRSLEYQYHSVVHPGPPQATTKSWKKRAVRSTPSLAGEIGAEN
NRGTNIQHISLNRRGKRQVPHGRIPPDGILPWELNSPSSEVSLVTVLGGLTVGLLTVCLA
VAAAVMCRNRSTKGKDTPKGSGSTEPMMSPQSHYNDSSEV
Download sequence
Identical sequences Q6NVD0
ENSMUSP00000088670 ENSMUSP00000088670 ENSMUSP00000088670 10090.ENSMUSP00000088670 NP_766450.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]