SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000089637 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000089637
Domain Number 1 Region: 1-83
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 4.41e-27
Family Ribosomal L11/L12e N-terminal domain 0.000013
Further Details:      
 
Domain Number 2 Region: 76-145
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.0000000000000222
Family Ribosomal protein L11, C-terminal domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000089637   Gene: ENSMUSG00000066983   Transcript: ENSMUST00000092011
Sequence length 162
Comment pep:known chromosome:GRCm38:17:70929058:70929546:1 gene:ENSMUSG00000066983 transcript:ENSMUST00000092011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKFHPNEIKVMYLRCTGGEVGATSALAPKIRPLDLSPKKVGDDIAKATGDWKGLRITV
KLSIQNRQTQIEVVPSALIIKALKEPPRDRKKQNIKHSGNFTFDEIVNITRQMRHRSLAR
ELSGTIKEILGTTQSVGCNVDGRHPHDVIDDINSGAVECPAS
Download sequence
Identical sequences F8VQK7
10090.ENSMUSP00000089637 ENSMUSP00000089637 ENSMUSP00000089637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]