SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000089648 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000089648
Domain Number 1 Region: 4-59
Classification Level Classification E-value
Superfamily Ribosomal protein L29 (L29p) 6.41e-16
Family Ribosomal protein L29 (L29p) 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000089648   Gene: ENSMUSG00000069439   Transcript: ENSMUST00000092020
Sequence length 118
Comment pep:known chromosome:GRCm38:15:81843343:81843699:-1 gene:ENSMUSG00000069439 transcript:ENSMUST00000092020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSGLRGKKKEELLKQLGDLKVELSQLRVAKVTGGATSKLSKIRVVRKSIAQVLTVISQTQ
KENLRKFFKGKKCKPLDLQPKKTRAMCRRLTKHEEKLKTKKQQRKEQLYPLRKYAGKA
Download sequence
Identical sequences F6XS56
ENSMUSP00000089648 ENSMUSP00000089648 ENSMUSP00000089648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]