SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000090452 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000090452
Domain Number 1 Region: 820-1024
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000243
Family WD40-repeat 0.026
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000090452
Domain Number - Region: 352-405
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.00196
Family RILP dimerisation region 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000090452   Gene: ENSMUSG00000020859   Transcript: ENSMUST00000092777
Sequence length 1169
Comment pep:known chromosome:GRCm38:11:94044205:94126080:1 gene:ENSMUSG00000020859 transcript:ENSMUST00000092777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPGCMLLFVFGFVGGAVVINSAILVSLSVLLLVHFSISTGVPALTQNLPRILRKERPIS
LGIFPLPAGDGLLTPDTQKGGETPGSEQWKFQELSQPRSHTSLKDELSDISQGGSKATTP
ASTANSDVSAIPPDTPSKEDNEGFVKGTDTSNKSEISKHIEVQVAQETRNVSTESGENEE
KSEVQAIIESTPELDMDKDLSGYKGSSTPTKGIENKAFDRNTESLFEELSSAGSGLIGDV
DEGADLLDHNFFGMGREVENLILENTQLLETKNALNVVKNDLIAKVDELTCEKDVLQGEL
EAVKQAKLKLEDKNRELEEELRKARAEAEDARQKAKDDDDSDIPTAQRKRFTRVEMARVL
MERNQYKERLMELQEAVRWTEMIRASRENPAMQEKKRSSIWQFFSRLFSSSSNATKKPEP
PVNLKYNAPTSHVTPSVKKRSSTLSQLPGDKSKAFDFLSEETEASLASRREQKREQYRQV
KAHVQKEDGRVQAFGWSLPQKYKQVANGQGETKMKNLPVPVYLRPLDEKDASMKLWCAVG
VNLSGGKTRDGGSVVGASVFYKDIAGLDTEGSKQRSASQSSLDKLDQELKEQQKEFKNQE
ELSSQVWICTSTHSTTKVIIIDAVQPGNILDSFTVCNSHVLCIASVPGARETDYPAGEEL
SESGQVDKASLCGSMTSNSSAEMDSLLGGITVVGCSTEGLTGAATSPSTNGASPVIEKPP
EMETENSEVDENIPTAEEATEATEGNAGSTEDTVDISQPGVYTEHVFTDPLGVQIPEDLS
PVFQSSNDSDVYKDQISVLPNEQDLAREEAQKMSSLLPTMWLGAQNGCLYVHSSVAQWRK
CLHSIKLKDSILSIVHVKGIVLVALADGTLAIFHRGVDGQWDLSNYHLLDLGRPHHSIRC
MTVVHDKVWCGYRNKIYVVQPKAMKIEKSFDAHPRKESQVRQLAWVGDGVWVSIRLDSTL
RLYHAHTYQHLQDVDIEPYVSKMLGTGKLGFSFVRITALMVSCNRLWVGTGNGVIISIPL
TETNKTSGTPGNRPGSVIRVYGDENSDKVTPGTFIPYCSMAHAQLCFHGHRDAVKFFVAV
PGQVISPQSSSGGADLTADKAGSSAQEPSSQTPLKSMLVISGGEGYIDFRMGDEGGESEL
LGEDLPLEPSVTKAERSHLIVWQVMCGNE
Download sequence
Identical sequences E9PUD1
NP_001020599.1.92730 ENSMUSP00000090452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]