SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000091315 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000091315
Domain Number 1 Region: 12-121
Classification Level Classification E-value
Superfamily POZ domain 4.32e-24
Family BTB/POZ domain 0.0011
Further Details:      
 
Domain Number 2 Region: 1011-1063
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.25e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 1050-1105
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000362
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 4 Region: 480-532
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000495
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 5 Region: 339-389
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000862
Family Classic zinc finger, C2H2 0.044
Further Details:      
 
Domain Number 6 Region: 450-495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000036
Family Classic zinc finger, C2H2 0.038
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000091315
Domain Number - Region: 1106-1151
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00192
Family Classic zinc finger, C2H2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000091315   Gene: ENSMUSG00000040433   Transcript: ENSMUST00000093798
Sequence length 1197
Comment pep:known chromosome:GRCm38:9:96685423:96731675:-1 gene:ENSMUSG00000040433 transcript:ENSMUST00000093798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVMSLSRDLKDDFHSDTVLSILNEQRIRGILCDVTIIVEDTKFKAHSNVLAASSLYFKN
IFWSHTICISSHVLELDDLKAEVFTEILNYIYSSTVVVKRQETVTDLAAAGKKLGISFLE
DLSDRNFSNSPGPYVVCITEKGVVKEEKNEKRHEEPAVTNGPRITNAFSIIETENSNNMF
SPLDLRASFKKVSDSMRTASLCQERASVCHEVEPVRTLAEHSYAVSSITEAYRSQPPREQ
DSSSSAKTGKETGDALATKAKPCRKPKPQTQDSDSTTENMPLSLVTCPEVNQERSPQPAP
DLSHSEPPSNEGDIHFPREDENQPSDAPGPGAAEVPPLVYNCSCCSKSFDSSTLLSAHMQ
LHKPTQEPFVCKYCNKQFTTLNRLDRHEQICMRSSHVPIPGGNPPFLENYPTIGQDGTSF
RSPESLGPENRIGELSSAGSALSDADHMVKFVNGQMLYSCIVCKRSYVTLSSLRRHANVH
SWRRTYPCHYCNKVFALAEYRTRHEIWHTGERRYQCIFCLETFMTYYILKNHQKSFHAID
HRLSINKKTANGGLKPTVYPYKLYRLLPMRCKRAPYKSYRNSSYVSAQGSSQRGESAPDT
FIVPNLQSSEMPTLDFQDGRNTLPSSPAVPVETPSRQGAPTSARVKNAEGIKWRKQAVKT
NLVDNFDSTEVSVSSTGNTVSATLQTEPACVSSVGKGSEHSASVISYSGSVPSVIVHSSQ
FSSVIKHSNTIASLTNSNHKSPSQPVVSPSLIKDSKPETDKASKPASRPKSIKEKKKTAP
SNRGEITEEAKYIADHGGSSGKTTNAEETSKIETYIAKPALPGTSTNSNVAPLCQITVKI
GNEAIVKRHILGSKLFYKRGRKPKYQMQEETLPRENDPETPGDSPLGLCQAECVEMSEAF
DEVSDQDSTDKPWRPYYNYKPKKKSKQLRKMRKVKWRKERRSRSPVGRCRYPAELDRAEV
KLPPDKAFEEEEEEEENKEMPKLQCELCDGCPDGAAGAGAEGKPHQHLTSKPYICELCAK
QFQSSSTLKMHMRCHTGEKPYQCKTCGRCFSVQGNLQKHERIHLGVKEFICQYCNKAFTL
NETLKIHERIHTGEKRYHCQFCFQGFLYLSTKRNHERRHIREHDGKGFACFQCPKICKTA
AALRMHQKKHLYKTLPKQEETGDTCHENADLLESQLCTDSEDSEQKDDIKAFAENVL
Download sequence
Identical sequences Q3LR78
ENSMUSP00000091315 ENSMUSP00000091315 ENSMUSP00000091315 ENSMUSP00000121753 NP_780746.2.92730 XP_006511253.1.92730 XP_006511254.1.92730 XP_006511255.1.92730 XP_006511256.1.92730 XP_006511257.1.92730 XP_006511258.1.92730 10090.ENSMUSP00000121753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]