SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000091374 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000091374
Domain Number 1 Region: 8-123
Classification Level Classification E-value
Superfamily POZ domain 4.71e-29
Family BTB/POZ domain 0.000000707
Further Details:      
 
Domain Number 2 Region: 555-609
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.61e-19
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 499-555
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.26e-16
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number 4 Region: 419-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000004
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 5 Region: 596-648
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000285
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000091374   Gene: ENSMUSG00000066687   Transcript: ENSMUST00000093852
Sequence length 673
Comment pep:known chromosome:GRCm38:9:48654311:48835945:-1 gene:ENSMUSG00000066687 transcript:ENSMUST00000093852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLTKMGMIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFE
ILFHRNSQHYTLDFLSPKTFQQILEYAYTATLQAKAEDLDDLLYAAEILEIEYLEEQCLK
ILETIQASDDNDTEATMADGGGEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPM
VDQSPSVSTSFGLSAMSPTKAAVDSLMSIGQSLLQGTLQPPAGPEEPTLAGGGRHPGVAE
VKMEMMQVDEAPGQDSPGAAESSISGGMGDKLEERSKEGPGTPTRGSVITSARELHYGRE
ESGEQLSPPVEAGQGPPGRQEPLAPPVEKHLGIYSVLPNHKADAVLSMPSSVTSGLHVQP
ALAVSMDFSTYGGLLPQGFIQRELFSKLGELAVGMKAESRPLGEQCSVCGVELPDNEAVE
QHRKLHSGMKTYGCELCGKRFLDSLRLRMHLLAHSAGAKAFVCDQCGAQFSKEDALETHR
QTHTGTDMAVFCLLCGKRFQAQSALQQHMEVHAGVRSYICSECNRTFPSHTALKRHLRSH
TGDHPYECEFCGSCFRDESTLKSHKRIHTGEKPYECNGCGKKFSLKHQLETHYRVHTGEK
PFECKLCHQRSRDYSAMIKHLRTHNGASPYQCTICTEYCPSLSSMQKHMKGHKPEEIPPD
WRIEKTYLYLCYV
Download sequence
Identical sequences Q3UQ17
ENSMUSP00000091374 10090.ENSMUSP00000091374 ENSMUSP00000091374 ENSMUSP00000091374 NP_001028496.1.92730 XP_006510321.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]