SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000091381 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000091381
Domain Number 1 Region: 515-535,575-679,793-908
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.56e-51
Family Phosphate binding protein-like 0.000036
Further Details:      
 
Domain Number 2 Region: 125-497
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.12e-24
Family L-arabinose binding protein-like 0.0087
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000091381
Domain Number - Region: 735-769
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0863
Family Voltage-gated potassium channels 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000091381   Gene: ENSMUSG00000039579   Transcript: ENSMUST00000093859
Sequence length 1135
Comment pep:known chromosome:GRCm38:4:49661611:49845549:-1 gene:ENSMUSG00000039579 transcript:ENSMUST00000093859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRLSLWWLLSRVCLLLPPPCALVLAGVPSSSSHPQPCQILKRIGHAVRVGAVHLQPWTT
APRAASRAQDGGRAGAQRDEPESGTWRPPAPSQGARWLGSALHGRGPPGSRKLGEGAGTE
TLWPRDALLFAVENLNRVEGLLPYNLSLEVVMAIEAGLGDLPLMPFSSPSSPWSSDPFSF
LQSVCHTVVVQGVSALLAFPQSQGEMMELDLVSSVLHIPVLSIVRHEFPRESQNPLHLQL
SLENSLSSDADVTVSILTMNNWYNFSLLLCQEDWNITDFLLLTENNSKFHLESIINITAN
LSSTKDLLSFLQVQLENIRNSTPTMVMFGCDMGSIRQIFEMSTQFGLSPPDLHWVLGDSQ
NVEELRTEGLPLGLIAHGKTTQSVFEYYVQDAMELVARAVATATMIQPELALLPSTMNCM
DVKTTNLTSGQYLSRFLANTTFRGLSGSIKVKGSTIVSSENNFFIWNLQYDPMGKPMWTR
LGSWQGGRIVMDSGIWPEQAQRHKTHFHHPNKLHLRVVTLIEHPFVFTREVDDEGLCPAG
QLCLDPMTNDSSILDSLFSSLHSSNDTVPIKFKKCCYGYCIDLLEQLAEDMNFDFDLYIV
GDGKYGAWKNGHWTGLVGDLLSGTANMAVTSFSINTARSQVIDFTSPFFSTSLGILVRTR
DTAAPIGAFMWPLHWTMWLGIFVALHITAIFLTLYEWKSPFGMTPKGRNRNKVFSFSSAL
NVCYALLFGRTAAIKPPKCWTGRFLMNLWAIFCMFCLSTYTANLAAVMVGEKIYEELSGI
HDPKLHHPSQGFRFGTVRESSAEDYVRQSFPEMHEYMRRYNVPATPDGVQYLKNDPEKLD
AFIMDKALLDYEVSIDADCKLLTVGKPFAIEGYGIGLPPNSPLTSNISELISQYKSHGFM
DVLHDKWYKVVPCGKRSFAVTETLQMGIKHFSGLFVLLCIGFGLSILTTIGEHIVYRLLL
PRIKNKSKLQYWLHTSQRFHRALNTSFVEEKQPCSKTKRVEKSRWRRWTCKTEGDSELSL
FPRSNMGPQQLMVWNTSNLSHDNQRKYIFNDEEGQNQLGTQTHQDIPLPPRRRELPASLT
TNGKADSLNVARNSVMQELSELEKQIQVIRQELQLAVSRKTELEEYQRTNRTCES
Download sequence
Identical sequences A2AIR5
NP_001263284.1.92730 ENSMUSP00000075970 10090.ENSMUSP00000091381 ENSMUSP00000091381 ENSMUSP00000091381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]