SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000091925 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000091925
Domain Number 1 Region: 5-261
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.09e-97
Family Carbonic anhydrase 0.00000000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000091925   Gene: ENSMUSG00000027556   Transcript: ENSMUST00000094365
Sequence length 261
Comment pep:known chromosome:GRCm38:3:14766217:14778459:-1 gene:ENSMUSG00000027556 transcript:ENSMUST00000094365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASADWGYGSENGPDQWSKLYPIANGNNQSPIDIKTSEANHDSSLKPLSISYNPATAKEI
VNVGHSFHVIFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGTRYSGELH
LVHWNSAKYSSASEAISKADGLAILGVLMKVGPANPSLQKVLDALNSVKTKGKRAPFTNF
DPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKDSISLSPEQLAQLRGLLSSAEGEPAV
PVLSNHRPPQPLKGRTVRASF
Download sequence
Identical sequences P13634
ENSMUSP00000091925 ENSMUSP00000091925 10090.ENSMUSP00000091925 NP_001077426.1.92730 NP_033929.2.92730 WP_050307170.1.23548 WP_050307170.1.3296 WP_050307170.1.49450 XP_011246439.1.92730 ENSMUSP00000091925 ENSMUSP00000137926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]