SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000092521 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000092521
Domain Number 1 Region: 92-126
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000589
Family LDL receptor-like module 0.0035
Further Details:      
 
Domain Number 2 Region: 139-168
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000942
Family LDL receptor-like module 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000092521
Domain Number - Region: 175-216
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000249
Family LDL receptor-like module 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000092521   Gene: ENSMUSG00000070877   Transcript: ENSMUST00000094916
Sequence length 218
Comment pep:novel chromosome:GRCm38:4:107209180:107218060:1 gene:ENSMUSG00000070877 transcript:ENSMUST00000094916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVGCERAEFCPACFWFLGQADAESNITTRRKARPGDEGCGPLCCSRRGACLSVGLLLLL
AMLAALLAVATILGHPPRTPETHSCVTLANRTGFLCHDRRHCIPAHAVCDGIRTCPHGED
EAESLCRDVPQSLPSFLLTTCGDPDSWIYSDQKCDGVNNCGDCSDELSPVTTCPPCGPGW
WRCSPTVFKYCSCVPRDLCRDSVQHCSDWSDEYSCPGP
Download sequence
Identical sequences D3YYZ1
ENSMUSP00000092521 ENSMUSP00000092521 10090.ENSMUSP00000092521 ENSMUSP00000092521 NP_001074741.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]