SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000093245 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000093245
Domain Number 1 Region: 3929-4067
Classification Level Classification E-value
Superfamily CalX-like 1.96e-30
Family CalX-beta domain 0.0021
Further Details:      
 
Domain Number 2 Region: 2113-2243
Classification Level Classification E-value
Superfamily CalX-like 3.01e-29
Family CalX-beta domain 0.0017
Further Details:      
 
Domain Number 3 Region: 2229-2380
Classification Level Classification E-value
Superfamily CalX-like 2.75e-28
Family CalX-beta domain 0.0044
Further Details:      
 
Domain Number 4 Region: 1005-1134
Classification Level Classification E-value
Superfamily CalX-like 3.53e-28
Family CalX-beta domain 0.0021
Further Details:      
 
Domain Number 5 Region: 2956-3084
Classification Level Classification E-value
Superfamily CalX-like 4.05e-28
Family CalX-beta domain 0.0024
Further Details:      
 
Domain Number 6 Region: 2594-2711
Classification Level Classification E-value
Superfamily CalX-like 9.42e-28
Family CalX-beta domain 0.0018
Further Details:      
 
Domain Number 7 Region: 1720-1808,1836-1872
Classification Level Classification E-value
Superfamily CalX-like 1.31e-27
Family CalX-beta domain 0.00059
Further Details:      
 
Domain Number 8 Region: 4261-4403
Classification Level Classification E-value
Superfamily CalX-like 5.62e-26
Family CalX-beta domain 0.0011
Further Details:      
 
Domain Number 9 Region: 144-291
Classification Level Classification E-value
Superfamily CalX-like 1.29e-25
Family CalX-beta domain 0.002
Further Details:      
 
Domain Number 10 Region: 1294-1493
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.67e-25
Family Trypanosoma sialidase, C-terminal domain 0.062
Further Details:      
 
Domain Number 11 Region: 1131-1277
Classification Level Classification E-value
Superfamily CalX-like 4.32e-23
Family CalX-beta domain 0.0041
Further Details:      
 
Domain Number 12 Region: 4995-5134
Classification Level Classification E-value
Superfamily CalX-like 9.02e-23
Family CalX-beta domain 0.0017
Further Details:      
 
Domain Number 13 Region: 4404-4524
Classification Level Classification E-value
Superfamily CalX-like 1.96e-22
Family CalX-beta domain 0.0037
Further Details:      
 
Domain Number 14 Region: 409-552
Classification Level Classification E-value
Superfamily CalX-like 5.62e-21
Family CalX-beta domain 0.0038
Further Details:      
 
Domain Number 15 Region: 775-927
Classification Level Classification E-value
Superfamily CalX-like 9.68e-21
Family CalX-beta domain 0.0065
Further Details:      
 
Domain Number 16 Region: 4656-4791
Classification Level Classification E-value
Superfamily CalX-like 9.81e-21
Family CalX-beta domain 0.0069
Further Details:      
 
Domain Number 17 Region: 3574-3660
Classification Level Classification E-value
Superfamily CalX-like 1.7e-20
Family CalX-beta domain 0.0029
Further Details:      
 
Domain Number 18 Region: 1876-1982
Classification Level Classification E-value
Superfamily CalX-like 2.22e-20
Family CalX-beta domain 0.0028
Further Details:      
 
Domain Number 19 Region: 1984-2125
Classification Level Classification E-value
Superfamily CalX-like 3.01e-20
Family CalX-beta domain 0.0022
Further Details:      
 
Domain Number 20 Region: 3665-3809
Classification Level Classification E-value
Superfamily CalX-like 4.19e-20
Family CalX-beta domain 0.0066
Further Details:      
 
Domain Number 21 Region: 3086-3202
Classification Level Classification E-value
Superfamily CalX-like 1.83e-18
Family CalX-beta domain 0.0045
Further Details:      
 
Domain Number 22 Region: 5209-5367
Classification Level Classification E-value
Superfamily CalX-like 1.96e-18
Family CalX-beta domain 0.002
Further Details:      
 
Domain Number 23 Region: 2818-2953
Classification Level Classification E-value
Superfamily CalX-like 3.01e-18
Family CalX-beta domain 0.0025
Further Details:      
 
Domain Number 24 Region: 2699-2833
Classification Level Classification E-value
Superfamily CalX-like 7.72e-18
Family CalX-beta domain 0.0025
Further Details:      
 
Domain Number 25 Region: 1581-1708
Classification Level Classification E-value
Superfamily CalX-like 1.18e-17
Family CalX-beta domain 0.0045
Further Details:      
 
Domain Number 26 Region: 263-398
Classification Level Classification E-value
Superfamily CalX-like 1.83e-17
Family CalX-beta domain 0.0045
Further Details:      
 
Domain Number 27 Region: 907-1004
Classification Level Classification E-value
Superfamily CalX-like 3.27e-17
Family CalX-beta domain 0.007
Further Details:      
 
Domain Number 28 Region: 668-804
Classification Level Classification E-value
Superfamily CalX-like 1.15e-16
Family CalX-beta domain 0.0074
Further Details:      
 
Domain Number 29 Region: 4047-4183
Classification Level Classification E-value
Superfamily CalX-like 8.24e-16
Family CalX-beta domain 0.0036
Further Details:      
 
Domain Number 30 Region: 2344-2389,2491-2566
Classification Level Classification E-value
Superfamily CalX-like 0.00000000000000128
Family CalX-beta domain 0.0036
Further Details:      
 
Domain Number 31 Region: 4166-4270
Classification Level Classification E-value
Superfamily CalX-like 0.00000000000000131
Family CalX-beta domain 0.0057
Further Details:      
 
Domain Number 32 Region: 5488-5640
Classification Level Classification E-value
Superfamily CalX-like 0.0000000000000119
Family CalX-beta domain 0.005
Further Details:      
 
Domain Number 33 Region: 37-158
Classification Level Classification E-value
Superfamily CalX-like 0.0000000000000301
Family CalX-beta domain 0.0024
Further Details:      
 
Domain Number 34 Region: 1495-1577
Classification Level Classification E-value
Superfamily CalX-like 0.0000000000000353
Family CalX-beta domain 0.0077
Further Details:      
 
Domain Number 35 Region: 3771-3906
Classification Level Classification E-value
Superfamily CalX-like 0.00000000000209
Family CalX-beta domain 0.0057
Further Details:      
 
Domain Number 36 Region: 4531-4642
Classification Level Classification E-value
Superfamily CalX-like 0.00000000000366
Family CalX-beta domain 0.0033
Further Details:      
 
Domain Number 37 Region: 4754-4863
Classification Level Classification E-value
Superfamily CalX-like 0.000000314
Family CalX-beta domain 0.019
Further Details:      
 
Domain Number 38 Region: 517-631
Classification Level Classification E-value
Superfamily CalX-like 0.00000115
Family CalX-beta domain 0.0074
Further Details:      
 
Domain Number 39 Region: 5358-5498
Classification Level Classification E-value
Superfamily CalX-like 0.0000405
Family CalX-beta domain 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000093245
Domain Number - Region: 3203-3244
Classification Level Classification E-value
Superfamily CalX-like 0.00549
Family CalX-beta domain 0.013
Further Details:      
 
Domain Number - Region: 3359-3530
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 0.0123
Family Tricorn protease N-terminal domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000093245   Gene: ENSMUSG00000069170   Transcript: ENSMUST00000095585
Sequence length 6298
Comment pep:known chromosome:GRCm38:13:81095068:81633154:-1 gene:ENSMUSG00000069170 transcript:ENSMUST00000095585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVTSEPGMISSFLLVYLSTLFISFVFGEAEIRFTGQTEFFVNETSTTVIRLVIERIGEP
ANVTAIVSLSGEDTGDFFDTYAAAFIPARGTNRTVYIAVCDDDLPEPDETFTFHLTLQKP
SANVKLGWPRAASVTILSNDNAFGIISFSTPSSISVIEPRSRNASVPLTLIREKGTYGMV
TVTFDVSGGPNPPEEDLNPVRGNITFPPGRATVIYNVTVLDDEVPENDELFLIQLRSVEG
GAEINASRSSVEIIVKKNDSPVNFMQSVYVVPEDDHVLTIPVLRGKDSDGNLIGSDETQV
SIRYKVMTWDSTAHAQQNVDFIDLQPDTTLVFPPFVHESHLKFQIIDDLIPEIAESFHIM
LLKNTLQGDAVLMGPSTVQVTIKPNDKPYGVLSFNSILFERPVIIDEDTASSSRFEEIAV
VRNGGTHGNVSVSWVLTRNSSDPSPVTADITPASGTLQFAQGQMLAPISLVVFDDDLPEE
AEAYLLTILPHTIQGGAEVSEPAQLLFYIQDSDNVYGEIAFFPGESQKIESSPSERSLSL
SLARRGGSKGDVRVIYSALYIPAGAMDPLRAKDGILNTSRRSSLLFPEQNQQVSIKLPIR
NDAFLQNGAHFLVQLEAVVLVNIFPPIPPVSPRFGEIRNISLLVTPAIANGEIGFLSNLP
IILHEPKDSSAEVVSIPLHRDGTDGQATVYWSLRPSGFNSKAVTLDDAGPFNGSVVFLSG
QNETSINITVKGDDIPELNETVTLSLDRVSVDSDVLKSGYTSRDLIILENDDPGGIFEFS
YDSRGPYVIKEGDAVELRITRSRGSLVKQFLRFHVEPRESNEFYGNMGVLEFTPGEREVV
ITLLTRLDGTPELDEHFWVILSSHGERESKLGCATLVNITILKNDYPHGIIEFVSDGLSA
SIKESKGEDIYHAVYGVIRTRGNFGAVNVSWMVSPDFTQDVFPVQGTVCFGDQEFFKNIT
VYSLVDEIPEEMEEFTIILLNATGGAQTGIRTTASLRILRNDDPVYFAEPCVLRVQEGET
ANFTVLRNGSVDGACTVQYATVDGKASGEEGDFAPVEKGETLVFEVGSREQSISVHVKDD
GIPETDEPFYIVLFNSTGDTVVYEYGVATVIIEANDDPNGVFSLEPIDKAVEEGKTNAFW
ILRHRGHFGNVSVAWQLFQNASLQPGQEFYETSGTVNFTDGEETKPVILRAFPDRIPEFN
EFYILRLVNISGPGGQLAETNFQVTVMIPFNDDPFGIFILDPECLEREVAEDVLSEDDMS
YITSFTILRQQGVFGDVRVGWEVLSREFTAGLPPMIDFILLGSFPSTVPLQPHMRRHHSG
TDVLYFSGLEGAFGTVDPKYQPFRNNTIANFTFSAWVMPNANTNGFLIAKDDSHGSIYYG
VKIQTNETHVTLSLHYKTFGSNVTYIAKSTVMKYLEEGVWLHVLIILDDGIIEFYLDGKA
MPRGIKSLKGEAITDGPGILRIGAGMDGGARFTGWMQDVRTYERKLTPEEIYELHAVPAR
TDLHPISGYLEFRQGESNKSFIVAARDDSEEEGEELFLLKLVSVDGGAQISKENTTARLR
IQKSDNANGLFGFTGACIPEMTEEGSTVSCVVERTRGALGYVHVFYTISQIESEGINYLV
DDFANASGTITFLPWQRSEVLNLYVLDEDMPELNEYFRVTLVSAVPGDGKLGSTPISGAS
IDPEKETTGITVKASDHPYGLMQFSTGLPPQPEDSMSLPASSVPHITVQEEDGEIRLLVI
RAQGLLGRVTVGFRTVSLTAFSPEDYQSTAGTLEFQSGERYKYIFVNITDNSIPELEKSF
KVELLNLDGGVSDLFRVDGSGSGEADTDFFLPPVLPHASLGVASQILVTIAASDHAHGVF
EFSPESLFVSGTEPEDGYSTVVLNVTRTRGALSAVTLQWKVDSDLDGDLAITSGNITFET
GQRIASITVEILSDEEPELDKALTVSILNVSSGSLGVLTNATLTILASDDPYGVFIFPNK
TRPLSVEEATQNVTLSIIRLKGLMGEVAVSYATIDDMEKPPYFPPNLARATQGGDYISAS
GLALFRANQTEATITISILDDAEPERSESVFIELFNSSLVDKVQNRPIPHSPRLGPKVET
VAHLVIVANDDAFGTVQLSATSVHVAENHVGPIINVTRTGGTFADVSVKFKAVPITAAAG
EDYSIASSDVVLLEGETTKAVPIYIINDIYPELEETFLVQLLNETTGGATLGPLREAVIT
IEASDDPYGLFGFQNTKFIVEEPEFNSVRVNVPIIRNSGTLGNVTVQWVAIINGQFATGD
LRVVSGNVTFAPGETIQTLLLEVLADDVPEIEEVVQVQLAAASGGGTIGLDRVANIVIPA
NDNPYGSVAFVQSVFRVQEPLERSSYANITVRRSGGHFGRLLLCYGTSDIDVVARAVEEG
EDVLSYYESPTQGVPDPLWRTWVNVSAVEETQYTCATLCLKERACSAFSVVSGAEGPRCF
WMTSWVSGTVNSSDFQTYKKNMTRVASLFSGQAVAGSDYEPVTRQWAVILEGDEFANLTV
SVLPDDAPEMDESFLISLLEVHLMNISDSFKNQPTIGHPNTSAVVIGLNGDAFGVFIIYS
VSPNTSEDGLCVEVQEQPQTSVELVIYRTGGSLGQVMVEWRVVGGTATEGLDFMGAGDIL
TFAEGETKKMAILTILDDSEPEDNESILVRLVATEGGSRILPSSDTVTVNILANDNVAGI
VSFQTASRSVIGHEGEMLQFHVVRTPPGRGNVTVNWKVVGQNLEVNFANFTGQLFFSEGT
LNKTIFVHLLDDNIPEEKEVYQVVLYDVKTQGVSPAGVALLDAQGYAAVLTVEASDEPHG
VLNFALSSRFVVLQEANVTIQLFVNREFGSLGAINVTYATVPGIVSLKNNTEGNLAEPES
DFIPVVGSLVLEEGETTAAISITVLEDDIPELKEYFLVNLTHVDLIMAPLTSSPPRLDSE
GLTAQIVIDANDGAQGMIEWQRNRFEVNETDGVVTLVAQRSRAALGQVSLFMYAQNLEAQ
AGLDYMCTPQILHFTDGERFKHVDVMILDDDMPEGDERFQLLLTNPSPGLELGKNTIALI
TVLANDDGPGVLSFNNSGHIFLREPTSLYVQESVAVLVIVREPAQGLFGTVAVQFVVTEV
NSSTESKDLSPSKGFIVLEEGVRSKTLRISAILDTEPEMDEHFVCTLFNPTGGARLGAHV
QTLITIFQNQAPLGLFSISAVENSATSIDVEESNRSVYLNVSRTNGLDLTASVQWETVSE
TAFGMRGMDVVFSIFQSFFDKTALDWCFFTVEGSVYGVMLRKSSLVVYRWQGTFVPVEDL
KVESPKTCEAFNIGVSPYLVITHGERSGEKPSINSVYMLTAGFRLVLIQTIIISGSCQVR
HFTSDSQDYFIIASRRNDSELTQVFRWNGNNFAWHQTLPVRGVLGMALFSRGGSVFLAIS
QANIRQTSLLFTWSGTQFINFQELPISGITQVEALSSGDDVYLCFAKNTFLGNQNAIDIF
VWEMGHSSLRYFQSLDFAAVKRIRSFTPASGIVHILLTAQDGSALYCWNSELNAFSFVLE
APAAHDAAFVTVKSLNSSKTLIALVGATDSHLYELTYVSSQSDFIPSLGELIFEPGDKEA
IIAVNVLDDTVPEKEESFRVQLKSPRGGAEIGINSSVRVTVLANDGAYGVVAFAQNSLHK
QLEELERDSLVTLNVERLRGTHGRITVAWEAAGSVSDVFPTSGVISFTEDQAMSMITLTV
LADDLPELSEAVVVTLTQIVTEGVEDPLKGATIDQSRSRSVLTILPSDSPYGVVRWHTES
LFNRVPEPTENITVVQLHIVRDKGLFGDISIHLIAKPNFLLHINNQATEDEDFVLQDSVI
IMKENIKETHAEVAILPDEVPELDEGLIVTIAAVNLVNPNFPAEQPRVQRPRMESAEILI
EENDDPRGIFNFHVVRDVGGVIIAHEGPPPLNVLQVPVVRMAGTFETVNVYWKATPDSAG
LEDFQPSHGMLQFADGQVIAPILVTIIDDSEFELLETFTISLVSVTGGGRLGDDVSVNVV
IAPNDSPFGIFGFEKKTVMVDGPLLSDDPDSYVTLTVVRSPGGKGAVRLHWAIEEKAKDD
LSPLNGTLYFDETESQKSVILHTLKDGMVGEDRRFIIELTAADEVEISPVKGSASVIIRG
DKSISEVGIASSSRHIIIGEPSATYNGTAIIDLVRGPGVSGEITVNWKILPPSRGEFVET
SGQLTMLDGQTAATVVIQALNDDIPEEKCHYEFQLTEISEGRMLHEASVSARITMVASDA
PYGRFSFSHEQLHVSEAAQRVNVTVVRSGGSFGRARVLYETGSRTAEAGWDFVPASGELL
FEAREKMKSLYIDILDDNLPEGPEEFVLAITRVDLQGRGYDFTIQENGLQIDQPPEIGNI
SIVRIIIMKNDNAEGIIEFDPKYTDISVEEDAGVITLPVLRLHGTYGHVSADFSSRGFSA
VPGGYVLHGSSVTFQHGQNLSFINVSIIDDNGSEFEKQFEILLIGATGGAILGRHLVSKI
TIAKSDSPFGIIRFLNQSKISLPNPSSTMALHLVLERTGGLLGEIQVSWEVVGPDAEEPL
PPHNGDFADPVSGTVSFGDGEGGVRSIILRVCPHEETEAEETFIVQLKPLREAKLDPRAK
AVTLTIQKFGDPNGVIHFAPESLSKRRFSEPPPSDGPLLVSFLVTRSKGTSGDIKVHWEL
SSEFDITRDFLSTRGFFTIADGESDASFDVHLLPDDVPEIEEEYAVQLVSVEGGAELDLG
KCTARFSVSANDDPHGVFALYSDRQSVLIGQNLDRSIQINITRLAGAFGAVAVRVQILSD
NKEDPVATENEERQLVITDGARYKVGLVPLKNQVFLSLGSNFTLQLVSVRLLSGPFYGIP
TILQEAKNAILSVPEEAANSQVGFESAAFQLMDIKAGTSQVMVSRKGTYGRLSVAWTTGY
APGSEIPEPIVIGNMTPTLGSLSFVHGEERKGVLLWTFPSPGRPEAFVLHLSGLRSSAAG
GAQLRSGFTTAEIEPMGVFQFSPSSRNITVSEDAQTIRICVQRLFGFHGDLIKVSYETTA
GSAKPPEDFEAVQKGEVFFQRFQPEIDFEITIINDQLPEIEETFYINLTSVETRGLGKGG
VNWRPRLNPDLSVAVVTIVDNDDLTGVAVSVPVTAGTVAVDSTLLAMETGSTTHPNKSKI
TTIPYTTEVFAPVTETVTVSAIPEKLATAHSVISVKPDVVPGTVLASVYGTLSIGPPIVY
VSEEMKNGTLSTADILIQRMGGFAGNVTITVKTFGGRCAQKEPSVWPFQDVYGVGNLTTW
AFEEEDFEEQLLTLTFLYGERERKIAVQILDDDEPEGQEFFYVFLTDPQGGAEIVRGKDS
TGFSAFAVIIISGSDLHNGIIGFSEESQRGLELREGADKNSQRLVVTRQPNRAFEEVQIF
WRVTLNQTVTILQEKGLNLTDELRFVAGVTTCTGGQTRCFIHLELNPKKVHQVEMPFFVE
LYDVTAGAAINNSARFAPIKLSKSGAPQSLVSFSVGSRLAVAHKKSTLISLQVARDSGTG
IMMSVNFITQELRSAETVGRVLISPAVSGKDFVRTEGTLVFEPGQKSAVLDVVLTPETGS
LNKFPKRFQIVLFDPKGGARIDKVYGTANITLISDADSQAVWGLEDLLHQPLHEDILNRV
LHNLNLRVATESTDEQLSAVMLIMEKITMEGRNQAFSIKSRTLLYELLCVLINPKRKDTR
GFSHFVEVAEHFAFSLLTDVTCGSPGEKSKTILDSCPYLSILALHWNPQQINGHKFEGKE
GDYIQIPERLLDVPEAEMLDGKNACTLVQFVEYSSQQWFIAGDNLPALKDKVLSLNVKGQ
SAQPLPNNNEVLYRIHAAEPRVVPHTSRCLLWNQAAASWLSDSQFCKVVEDASDYVECAC
SHMSVYAVYAQTDNSSSYNEAFFSAGLICISGLCLAVVSHMFCARHSMFAAKLLTHMMVA
SLGTQILFLASAYASPHLSEESCSAVAAVAHYLYLCQFSWMLIQSVNFWYVLVVSDEHTE
RRCLLFCLLSWGLPSFVVILLILILRGIYHRSMPQIYGLIHGDLCFIPNIYAALFTAALV
PLMCLVVVFVVFIHAYQLKPQWKGYDDVFRGRTNAAEIPLILYLFALISMTWLWGGLHMA
YRHFWMLVLFVIFNSLQGLYVFVVYFILHNQTCCPMKASYTVEMNGHPGPSTAFFTPGSG
IPPAGEINKSTQNLINAMEEVPSDWERSSFQQTSQASPDLKTSPQNGASFPSSGGYGPGS
LIADEESQEFDDLIFALKTGAGLSVSDNESGQGSQEGGTLTDSQIVELRRIPIADTHL
Download sequence
Identical sequences B8JJE0
ENSMUSP00000123552 10090.ENSMUSP00000093245 NP_473394.3.92730 ENSMUSP00000093245 ENSMUSP00000093245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]