SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000093965 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000093965
Domain Number 1 Region: 396-744
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.61e-86
Family YicI catalytic domain-like 0.00011
Further Details:      
 
Domain Number 2 Region: 746-828
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.51e-21
Family Putative glucosidase YicI, domain 3 0.0074
Further Details:      
 
Domain Number 3 Region: 88-177,264-393
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.00000000000000691
Family YicI N-terminal domain-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000093965   Gene: ENSMUSG00000071650   Transcript: ENSMUST00000096246
Sequence length 966
Comment pep:known chromosome:GRCm38:19:8898090:8916663:1 gene:ENSMUSG00000071650 transcript:ENSMUST00000096246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAIAAVAARRRRSWLSLVLAYLGVCLGITLAVDRSNFKTCDESSFCKRQRSIRPGLSPY
RALLDTLQLGPDALTVHLIHEVTKVLLVLELQGLQKNMTRIRIDELEPRRPRYRVPDVLV
ADPPTARLSVSGRDDNSVELTVAEGPYKIILTAQPFRLDLLEDRSLLLSVNARGLMAFEH
QRAPRVPFSDKVSLALGSVWDKIKNLFSRQESKDPAEGNGAQPEATPGDGDKPEETQEKA
EKDEPGAWEETFKTHSDSKPYGPTSVGLDFSLPGMEHVYGIPEHADSLRLKVTEGGEPYR
LYNLDVFQYELNNPMALYGSVPVLLAHSFHRDLGIFWLNAAETWVDISSNTAGKTLFGKM
LDYLQGSGETPQTDIRWMSESGIIDVFLMLGPSVFDVFRQYASLTGTQALPPLFSLGYHQ
SRWNYRDEADVLEVDQGFDDHNMPCDVIWLDIEHADGKRYFTWDPTRFPQPLNMLEHLAS
KRRKLVAIVDPHIKVDSGYRVHEELRNHGLYVKTRDGSDYEGWCWPGSASYPDFTNPRMR
AWWSNMFSFDNYEGSAPNLYVWNDMNEPSVFNGPEVTMLKDAVHYGGWEHRDIHNIYGLY
VHMATADGLIQRSGGIERPFVLSRAFFSGSQRFGAVWTGDNTAEWDHLKISIPMCLSLAL
VGLSFCGADVGGFFKNPEPELLVRWYQMGAYQPFFRAHAHLDTGRREPWLLASQYQDAIR
DALFQRYSLLPFWYTLFYQAHKEGFPVMRPLWVQYPEDMSTFSIEDQFMLGDALLIHPVS
DAGAHGVQVYLPGQEEVWYDIQSYQKHHGPQTLYLPVTLSSIPVFQRGGTIVPRWMRVRR
SSDCMKDDPITLFVALSPQGTAQGELFLDDGHTFNYQTRHEFLLRRFSFSGSTLVSSSAD
PKGHLETPIWIERVVIMGAGKPAAVVLQTKGSPESRLSFQHDPETSVLILRKPGVSVASD
WSIHLR
Download sequence
Identical sequences A1A4T2
ENSMUSP00000093965 ENSMUSP00000093965 NP_032086.1.92730 10090.ENSMUSP00000093965 ENSMUSP00000093965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]