SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000094906 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000094906
Domain Number 1 Region: 157-307
Classification Level Classification E-value
Superfamily E set domains 6.79e-23
Family Arrestin/Vps26-like 0.038
Further Details:      
 
Domain Number 2 Region: 6-141
Classification Level Classification E-value
Superfamily E set domains 2.38e-18
Family Arrestin/Vps26-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000094906   Gene: ENSMUSG00000073380   Transcript: ENSMUST00000097303
Sequence length 325
Comment pep:known chromosome:GRCm38:17:56294113:56300286:-1 gene:ENSMUSG00000073380 transcript:ENSMUST00000097303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVVKSIEVVLPQDAVYLAGSIIDGQVVLTLNSTLVDPVVKVELVGRGYVEWNEEIGETR
DYSRDVICNNKADYVHKTKTFPIKDNWLRAGSHTFDFHFNLPPRLPSTFNSKIGHISYFV
QALCLDREHILAKKKLYLLVQGISEFRQRNLSENSVSVEAEKKVSYNCCSQGWVSLHVQM
SKNTYVPGEKVTFTSEIRNHTGKYIKTVVFALYAHVQYEGFTPSAERRRRADSSELLRQM
ANARIPAFNSTTVVSAFNLPLVLSVSSGSQENEIMRTSYELVVTIHLPWSLSTVKARLPI
IITSTREGQADCPRLDELPYEDHMV
Download sequence
Identical sequences Q497K5
NP_084075.1.92730 10090.ENSMUSP00000094906 ENSMUSP00000094906 ENSMUSP00000094906 ENSMUSP00000094906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]