SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000095568 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000095568
Domain Number 1 Region: 240-422
Classification Level Classification E-value
Superfamily vWA-like 0.00000000227
Family Integrin A (or I) domain 0.074
Further Details:      
 
Domain Number 2 Region: 728-836
Classification Level Classification E-value
Superfamily Sensory domain-like 0.00000753
Family YkuI C-terminal domain-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000095568   Gene: ENSMUSG00000028532   Transcript: ENSMUST00000097955
Sequence length 1210
Comment pep:known chromosome:GRCm38:4:100776675:101029220:1 gene:ENSMUSG00000028532 transcript:ENSMUST00000097955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAREPEEEETVRPAAVVRRCPRCPGWPGAPRPPLWLLCLVACWILGAVADADFSILDEAQ
VLASQMRRLAAEELGVVTMQRIFNSLVYTEKISNGESEVQQLAKKIREKFNRYLDVVNRN
KQVVEASYTAHLTSPLTAIQDCCTIPPSMMEFDGNFNTNVSRTVSCDRLSTTVNSRAFNP
GRDLNSVLADNLKSNPGIKWQYFSSEEGIFTVFPAHKFRCKGSYEHRSRPIYVSTVRPQS
KHIVVILDHGASVTDTQLQIAKDAAQVILSAIDEHDKISVLTVADAVRTCSLDQCYKTYL
SPATSETKRKMSTFVSSVKPSDSPTQHAVGFHRAFQLIRSTSNSTRFQANTDMVIIYLSA
GITSKDSSEEDKKATLRVINEENGFLNNSVMILTYALMNDGVTGLKELAFLRDLAEQNSG
KYGIPDRTALPVIKGSMMVLNQLSNLETTVGRFYTNLPNRMIDEAVFSLPFSDEMGDGLI
MTVSKPCYFGNLLLGIVGVDVNLAYILEDVTYYQDSLASYTFLIDDKGYTLMHPSLTRPY
LLSEPPLHTDIIHYENIPKFELVRQNILSLPLGSQIITVPVNSSLSWHINKLRETGKEAY
NVSYAWKMVQDTSFILCIVVIQPEIPVKQLKNLNTVPSSKLLYHRLDLLGQPSACLHFKQ
LATLESPTVMLSAGSFSSPYEHLSQPETKRMVEHYTAYLSDNTRLIANPGLKFSVRNEVM
ATSHVTDEWMTQMEMSSLNTYIVRRYIATPNGVLRIYPGSLMDKAFDPTRRQWYLHAVAN
PGLISLTGPYLDVGGAGYVVTISHTIHSSSTQLSSGHTVAVMGIDFTLRYFYKVLMDLLP
VCNQDGGNKIRCFIMEDRGYLVAHPTLVDPKGHAPLEQQHITHKEPLVANDILNHPNFVK
KNLCNSFSDRTVQRSYKFNTSLVGDLTNLVHGSHCSKYRLTRIPGTNAFVGIVNETCDSL
AFCACSMVDRLCLNCHRMEQNECECPCECPLEVNECTGNLTNAENRNPSCEVHQEPVTYT
AIDPGLQDALQQCVNSRCNQRMESGDCFGVLDCEWCVVDSDGKTHLDKSYCAPQKECFGG
IVGAKSPYVDDMGAIGDEVITLNMIKSAPVGPVAGGIMGCIMVLVLAVYAYRHQIHRRSH
QHMSPLAAQEMSVRMSNLENDRDERDDDSHEDRGIISNTRFIAAVMERHVHSPERRRRYW
GRSGTESDHG
Download sequence
Identical sequences Z4YK18
ENSMUSP00000095568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]