SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000095949 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000095949
Domain Number 1 Region: 622-1151
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.1e-151
Family alpha-mannosidase, C-terminal domain 0.00000181
Further Details:      
 
Domain Number 2 Region: 124-499
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.9e-139
Family alpha-mannosidase 0.000000000934
Further Details:      
 
Domain Number 3 Region: 502-615
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 4.9e-29
Family alpha-mannosidase, domain 2 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000095949   Gene: ENSMUSG00000038886   Transcript: ENSMUST00000098346
Sequence length 1152
Comment pep:known chromosome:GRCm38:7:80349098:80371375:-1 gene:ENSMUSG00000038886 transcript:ENSMUST00000098346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLKKQVTVCGAAIFCVAVFSLYLMLDRVQHDPARHQNGGNFPRSQISVLQNRIEQLEQL
LEENHDIISRIKDSVLELTANAEGPPALLPYHTANGSWAVLPEPRPSFFSVSPQDCQFAL
GGRGQKPELQMLTVSEDLPFDNVEGGVWRQGFDISYSPNDWDTEDLQVFVVPHSHNDPGW
IKTFDKYYTEQTQHILNSMVSKLQEDPRRRFLWAEVSFFAKWWDNISAQKRAAVRRLVGN
GQLEIATGGWVMPDEANSHYFALVDQLIEGHQWLERNLGATPRSGWAVDPFGHSSTMPYL
LRRANLTSMLIQRVHYAIKKHFAATHSLEFMWRQMWDSDSSTDIFCHMMPFYSYDVPHTC
GPDPKICCQFDFKRLPGGRINCPWKVPPRAITEANVADRAALLLDQYRKKSRLFRSNVLL
VPLGDDFRYDKPQEWDAQFFNYQRLFDFLNSKPEFHVQAQFGTLSEYFDALYKRTGVEPG
ARPPGFPVLSGDFFSYADREDHYWTGYYTSRPFYKSLDRVLEAHLRGAEILYSLALAHAR
RSGLAGQYPLSDFALLTEARRTLGLFQHHDAITGTAKEAVVVDYGVRLLRSLVSLKQVII
NAAHYLVLGDQETYSFDPGTPFLQMDDSRVSHDALPERTVIRLDSSPRFVVVFNPLEQER
LSVVSLLVNSPRVRVLSEEGQPLSVQISVHWSSATDMVPDVYQVSVPVRLPGLGLGVLQL
QPDLDGPYTLQSSVRVYLNGVKLSVSRQSAFPVRVVDSGASDFAISNRYMQVWFSGLTGL
LKSIRRVDEEQEQQMELEFLVYGTRTSKDKSGAYLFLPDSEAKPYVPKKPPVLRVTEGPF
FSEVAVYYEHFHQVIRLYNLPGVEGLSLDMSFQVDIRDYVNKELALRIHTDIDSQGTFFT
DLNGFQIQPRQYLKKLPLQANFYPMPVMAYIQDSQRRLTLHTAQALGVSSLGNGQLEVIL
DRRLMQDDNRGLGQGLKDNKITCNRFRLLLERRTTMSPEVHQEQERSTSYPSLLSHLTSM
YLSTPPLVLPVAKRQGTSPALRSFHPLASPLPCDFHLLNLRMLPAEDTLPATDSALILHR
KGFDCGLEAKNLGFNCTTSQGKLALGSLFHGLDVTFLQPTSLTLLYPLASPSNSTDISLE
PMEISTFRLRLG
Download sequence
Identical sequences Q197W7 Q8BRK9
ENSMUSP00000095949 10090.ENSMUSP00000095949 ENSMUSP00000127585 ENSMUSP00000095949 NP_766491.2.92730 XP_006540662.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]