SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000096377 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000096377
Domain Number - Region: 251-287
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.0536
Family RILP dimerisation region 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000096377   Gene: ENSMUSG00000074358   Transcript: ENSMUST00000098780
Sequence length 511
Comment pep:known chromosome:GRCm38:7:18890883:18910415:-1 gene:ENSMUSG00000074358 transcript:ENSMUST00000098780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQPAGLQVDYIFRGVEHAVRVVVSGQVLELEVEDRMTADQWRGEFDANFIEDLTHKTGN
FKQFSIFCNMLESALTQSSESVTLDLLTYTDLESLRSRKLGGRPGALAPRSAQLNSKRYL
ILIYSVEFDRIHYPLPLPYQGKPDPVVLQGIIRSLKEELGHLRGLNGGQDARETEIWHLR
EQVTRLTSEKRELEAQLGRSREEALAGRAARQEAESLRGLVRGLELELRQERGLGGRAAG
RRSQDSRRLAKELEEVKASERNLRARLKTLNSELAMYRRGRRTLPPVAVREGRASSSRER
STSRGRAVTRSSSRESSRGARGRGRPAHPSPSPTGSRAPRFDPTAFVKAKEKKQREIRMK
QQQQQRNRMGSGGSGDGPSVSWSQQTRPAAAVTGRGDAVNRSRNRSSSVDSFRSRCSSVS
SCSELEDFSHSVSRSRRCRGRGKPPSPTPWSRSKTKSTTQERSDHQRHLASSGGWVPIKE
YSSDFQGADMAEIDARLKALQEYMNRLDTRS
Download sequence
Identical sequences Q3UJV1
ENSMUSP00000096377 10090.ENSMUSP00000096377 NP_001028486.1.92730 XP_006539877.2.92730 XP_006539878.1.92730 XP_006539879.1.92730 XP_006539881.1.92730 ENSMUSP00000096377 ENSMUSP00000096377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]