SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000096415 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000096415
Domain Number 1 Region: 325-381
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0000000000324
Family VPS37 C-terminal domain-like 0.013
Further Details:      
 
Domain Number 2 Region: 62-130
Classification Level Classification E-value
Superfamily UBC-like 0.00000000197
Family UBC-related 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000096415   Gene: ENSMUSG00000031600   Transcript: ENSMUST00000098817
Sequence length 397
Comment pep:known chromosome:GRCm38:8:40511783:40551134:1 gene:ENSMUSG00000031600 transcript:ENSMUST00000098817 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWLFPLAKSASSSAAGSPAGLTSLQQQKQRLIESLRNSHSSIAEIQKDVEYRLPFTVNN
LTININILLPPQFPQEKPVISVYPPIRHHLMDSQGLYVTSPLVSNFTMHSDLGKIIQSLL
DEFWKNPPVLAPTSTTFPYLYSNPGGMPPYPSQGFPFLPPYPPPEANRNITSLSVADTVS
SSTTSYTAAKPVAPSFGILSSLPLPVPTTESSASVNQNGFGYKMPDIPDAFPELSELSVS
QLTDMNEQEEVLLEQFLMLPQLKQIITDKEDLVKNIEELARKNLLLEHSLEGKRQTVLDK
YELLLQMKSTFEKKMQRQHELSESCSASALQARLKVAAHEAEEESDNIAEDFLEGKTEID
DFLNSFKEKRTICHCRRAKEEKLHQVIAMHSQFHAPL
Download sequence
Identical sequences Q8CHS8
NP_291038.2.92730 ENSMUSP00000096415 10090.ENSMUSP00000096415 ENSMUSP00000096415 ENSMUSP00000096415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]