SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000097108 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000097108
Domain Number 1 Region: 180-376
Classification Level Classification E-value
Superfamily E set domains 4.67e-76
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000463
Further Details:      
 
Domain Number 2 Region: 71-196
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.44e-23
Family Voltage-gated potassium channels 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000097108   Gene: ENSMUSG00000043301   Transcript: ENSMUST00000099508
Sequence length 425
Comment pep:known chromosome:GRCm38:16:94761080:94997696:-1 gene:ENSMUSG00000043301 transcript:ENSMUST00000099508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMAKLTESMTNVLEGDSMDQDVESPVAIHQPKLPKQARDDLPRHISRDRTKRKIQRYVR
KDGKCNVHHGNVRETYRYLTDIFTTLVDLKWRFNLLIFVMVYTVTWLFFGMIWWLIAYIR
GDMDHIEDPSWTPCVTNLNGFVSAFLFSIETETTIGYGYRVITDKCPEGIILLLIQSVLG
SIVNAFMVGCMFVKISQPKKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIR
AKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLP
KEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETY
ETSTPSLSAKELAELANRAELPLSWSVSSKLNQHAELETEEEEKNPEELTERNGDVANLE
NESKV
Download sequence
Identical sequences Q0VB45 Q54A91
ENSMUSP00000097108 ENSMUSP00000097108 NP_034736.2.92730 NP_037324.1.100692 NP_037324.1.4139 XP_021065143.1.100879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]