SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000097442 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000097442
Domain Number 1 Region: 915-1252
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 2.09e-114
Family Methionine synthase SAM-binding domain 0.0000000646
Further Details:      
 
Domain Number 2 Region: 9-402
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 9.03e-112
Family Homocysteine S-methyltransferase 0.0000142
Further Details:      
 
Domain Number 3 Region: 359-633
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 5.63e-85
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.00063
Further Details:      
 
Domain Number 4 Region: 757-909
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 1.83e-44
Family Cobalamin (vitamin B12)-binding domain 0.00000251
Further Details:      
 
Domain Number 5 Region: 653-742
Classification Level Classification E-value
Superfamily Methionine synthase domain 5.62e-27
Family Methionine synthase domain 0.0000335
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000097442   Gene: ENSMUSG00000021311   Transcript: ENSMUST00000099856
Sequence length 1253
Comment pep:known chromosome:GRCm38:13:12186542:12258113:-1 gene:ENSMUSG00000021311 transcript:ENSMUST00000099856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKTLQDEIEAILRKRIMVLDGGMGTMIQRYKLSEEHFQGQEFKDHSRPLKGNNDILSIT
QPDIIYQIHKEYLLAGADIIETNTFSSTSIAQADYGLEHLAYRMNKCSADVARKAAEEIT
LQTGVKRFVAGALGPTNKTLSVSPSVERPDYRNITFDELVDAYQEQAKGLLDGRVDILLI
ETIFDTANAKAALFAIQNLFEENYAPPRPIFISGTIVDKSGRTLSGQTGEAFVTSVSHSD
PLCIGLNCSLGAAEMRPFIETIGKCTTAYVLCYPNAGLPNTFGDYDETPSTMATHLKDFA
VDGLVNIVGGCCGSTPDHIREIAEAVKKCKPRVPPASVFEGHMLLSGLEPFRIGPYTNFV
NIGERCNVAGSRKFAKLIMAGNYEEALSIAKAQVEMGAQVLDINMDDGMLDGPSAMTRFC
NSIASEPDIAKVPLCIDSSNFAVIEAGLKCCQGKCIVNSISLKEGEGDFLEKARKIKKFG
AAVVVMAFDEEGQATETDVKVNVCTRAYHLLVDKVGFNPNDIIFDPNILTIGTGMEEHNL
YAINFIHATRVIKETLPGVRISGGLSNLSFSFRGMEAIREAMHGVFLYHAIKFGMDMGIV
NAGNLPVYDAIHKDLLQLCEDLIWNKDSEATEKLLRYAQTHGTGGKKVIQTDEWRNGSIE
ERLEYALVKGIEKHIVEDTEEARLNGEKYPRPLNIIEGPLMNGMKVVGDLFGAGKMFLPQ
VIKSARVMKKAVGHLIPFMEKEREEARLINGSVEEEDPYQGTIVLATVKGDVHDIGKNIV
GVVLACNNFRVIDLGVMTPCDKILQAALDHKADIIGLSGLITPSLDEMIFVAKEMERLAI
KIPLLIGGATTSRTHTAVKIAPRYSAPVIHVLDASKSVVVCSQLLDENLRDDYFEEILEE
YEDIRQDHYESLKERKYVPLSQARKHGFHIDWLSEPHPVKPTFIGTQVFEDYNLQKLVDY
IDWKPFFDVWQLRGKYPNRGFPKIFNDKAVGEEARKVYNDAQNMLNILISQKKLQARGVV
GFWPAQSVQDDIHLYAEGVVPQAAEPIATFYGLRQQAEKDSSSTDPYHCLSDFIAPLHSG
VCDYLGLFAVACFGVEELSKTYEDDGDDYSSIMVKALGDRLAEAFAEELHERVRRELWAY
SRSEQLGVPDLRRLRYEGIRPAPGYPSQPDHTEKLTMWRLASIEQATGIRLTESLAMAPA
SAVSGLYFSNVKAKYFAVGKISKDQTEDYALRKNMPVAEVEKWLGPILGYDTD
Download sequence
Identical sequences A6H5Y3
NP_001074597.1.92730 ENSMUSP00000097442 10090.ENSMUSP00000097442 ENSMUSP00000097442 ENSMUSP00000097442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]