SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000098338 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000098338
Domain Number 1 Region: 154-221
Classification Level Classification E-value
Superfamily DNA clamp 0.00000119
Family DNA polymerase processivity factor 0.033
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000098338
Domain Number - Region: 36-100
Classification Level Classification E-value
Superfamily DNA clamp 0.0173
Family DNA polymerase processivity factor 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000098338   Gene: ENSMUSG00000022248   Transcript: ENSMUST00000100775
Sequence length 272
Comment pep:known chromosome:GRCm38:15:10486069:10499063:1 gene:ENSMUSG00000022248 transcript:ENSMUST00000100775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLTQYNEEEYEQYCLVASLDNVRNLSTVLKAIHFREHATCFATKNGIKVTVENAKCVQ
ANAFIQADVFQEFVIQEESVTFRINLTILLDCLSIFGSSPTPGTLTALRMCYQGYGHPLM
LFLEEGGVVTVCKITTQEPEETLDFDFCSTNVMNKIILQSEGLREAFSELDMTGDVLQIT
VSPDKPYFRLSTFGNAGNSHLDYPKDSDLVEAFHCDKTQVNRISDVKYSCKTWLQLPEGV
GYDPLSGLEWTLSERDGEQEVAQWVNVVPVQA
Download sequence
Identical sequences ENSMUSP00000098338 NP_001276377.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]