SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000098972 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMUSP00000098972
Domain Number - Region: 34-109
Classification Level Classification E-value
Superfamily ALDH-like 0.0226
Family ALDH-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000098972   Gene: ENSMUSG00000029810   Transcript: ENSMUST00000101429
Sequence length 263
Comment pep:known chromosome:GRCm38:6:48833811:48841117:-1 gene:ENSMUSG00000029810 transcript:ENSMUST00000101429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQSTVTVNGVKVASTHPQSAHISIHIHQKSALEQLLGAVGSLKKFLSWPQARIHYGQLS
LGVTQILLGLVSCALGVCLYFGPWTELCAFGCAFWSGSVAILAGVGTIVHEKRQGKLSGQ
VSCLLLLACIATAAAATVLGVNSLIRQTSVPYYVEIFSTCNPLQSSMDPGYGTVRYSDDS
DWKTERCREYLNMMMNLFLAFCIMLTVVCILEIVVSVASLGLSLRSMYGRSSQALNEEES
ERKLLDGHPAPASPAKEKIPAIL
Download sequence
Identical sequences Q9R1Q6
10090.ENSMUSP00000098972 ENSMUSP00000098972 ENSMUSP00000098972 ENSMUSP00000128705 ENSMUSP00000131064 NP_001157679.1.92730 NP_001157680.1.92730 NP_001157681.1.92730 NP_001273580.1.92730 NP_001273581.1.92730 NP_075543.1.92730 XP_006506519.1.92730 XP_006506520.1.92730 XP_006506521.1.92730 XP_006506522.1.92730 XP_006506523.1.92730 XP_006506524.1.92730 XP_017177199.1.92730 ENSMUSP00000098972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]