SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000098975 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000098975
Domain Number 1 Region: 337-426
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.09e-19
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00057
Further Details:      
 
Domain Number 2 Region: 163-215
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000644
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.027
Further Details:      
 
Domain Number 3 Region: 60-119
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000864
Family HLH, helix-loop-helix DNA-binding domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000098975   Gene: ENSMUSG00000021010   Transcript: ENSMUST00000101432
Sequence length 925
Comment pep:known chromosome:GRCm38:12:53248677:54072175:1 gene:ENSMUSG00000021010 transcript:ENSMUST00000101432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRAGAAANGTPQNVQGITSYQQRITAQHPLPNQSECRKIYRYDGIYCESTYQNLQALRK
EKSRDAARSRRGKENFEFYELAKLLPLPAAITSQLDKASIIRLTISYLKMRDFANQGDPP
WNLRMEGPPPNTSVKGAQRRRSPSALAIEVFEAHLGSHILQSLDGFVFALNQEGKFLYIS
ETVSIYLGLSQVELTGSSVFDYVHPGDHVEMAEQLGMKLPPGRGLLSQGTTEDAASSASS
SSQSETPEPVETTSPSLLTTDNTLERSFFIRMKSTLTKRGVHIKSSGYKVIHITGRLRLR
VSLSHGRTVPSQIMGLVVVAHALPPPTINEVRIDCHMFVTRVNMDLNIIYCENRISDYMD
LTPVDIVGKRCYHFIHAEDVEGIRHSHLDLLNKGQCVTKYYRWMQKNGGYIWIQSSATIA
INAKNANEKNIIWVNYLLSNPEYKDTPMDIAQLPHLPEKASESSETSDSESDSKDTSGIT
EDNENSKSDEKGNQSENSEDPEPDRKKSGSACDNDMNCNDDGHSSSNPDSRDSDDSFEHS
DFEHPKAAEDGFGALGPMQIKVERYVESEADLRLQPCESLTSDSAKDSDSANEAGAQASS
KHQKRKRRRKRQKGGSASRRRLSSASSPGLDAGLVEPPRLLSSPHSASVLKIKTEIAEPI
NFDNDSSIWNYPPNREISRNESPYSMTKPPTSEHFPSPQGQGGSSGGGGALHVAIPDSVL
TPPGADGTAGRKTQFSGTAPVPSDPLSPPLSASPRDKHPGGGAGSGGGGPGASNSLLYTG
DLEALQRLQAGNVVLPLVHRVTGTLAATSTAAQRVYTTGTIRYAPAEVTLAMQGNLLPNA
HAVNFVDVNSPGFGLDPKTPMEMLYHHVHRLNMSGPFGGAVSAASLTQMPGGNVFTTAEG
LFSTLPFPVYSNGIHAAQTLERKED
Download sequence
Identical sequences F8VQB2
ENSMUSP00000098975 10090.ENSMUSP00000021396 ENSMUSP00000098975 NP_038808.2.92730 ENSMUSP00000098975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]