SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000099139 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000099139
Domain Number 1 Region: 21-264
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.06e-79
Family Calponin-homology domain, CH-domain 0.0000906
Further Details:      
 
Domain Number 2 Region: 1328-1442
Classification Level Classification E-value
Superfamily E set domains 4.4e-36
Family Filamin repeat (rod domain) 0.0000172
Further Details:      
 
Domain Number 3 Region: 1040-1152
Classification Level Classification E-value
Superfamily E set domains 1.8e-35
Family Filamin repeat (rod domain) 0.00000223
Further Details:      
 
Domain Number 4 Region: 1518-1636
Classification Level Classification E-value
Superfamily E set domains 5e-35
Family Filamin repeat (rod domain) 0.00000299
Further Details:      
 
Domain Number 5 Region: 1442-1551
Classification Level Classification E-value
Superfamily E set domains 3.34e-33
Family Filamin repeat (rod domain) 0.0000184
Further Details:      
 
Domain Number 6 Region: 452-569
Classification Level Classification E-value
Superfamily E set domains 1.33e-31
Family Filamin repeat (rod domain) 0.00075
Further Details:      
 
Domain Number 7 Region: 1822-1917
Classification Level Classification E-value
Superfamily E set domains 6.14e-31
Family Filamin repeat (rod domain) 0.00000326
Further Details:      
 
Domain Number 8 Region: 1143-1250
Classification Level Classification E-value
Superfamily E set domains 8.67e-31
Family Filamin repeat (rod domain) 0.0000383
Further Details:      
 
Domain Number 9 Region: 2007-2100
Classification Level Classification E-value
Superfamily E set domains 2.32e-30
Family Filamin repeat (rod domain) 0.0000174
Further Details:      
 
Domain Number 10 Region: 1239-1350
Classification Level Classification E-value
Superfamily E set domains 1.73e-29
Family Filamin repeat (rod domain) 0.0000158
Further Details:      
 
Domain Number 11 Region: 668-764
Classification Level Classification E-value
Superfamily E set domains 5.4e-29
Family Filamin repeat (rod domain) 0.00047
Further Details:      
 
Domain Number 12 Region: 856-967
Classification Level Classification E-value
Superfamily E set domains 2e-27
Family Filamin repeat (rod domain) 0.00066
Further Details:      
 
Domain Number 13 Region: 2280-2371
Classification Level Classification E-value
Superfamily E set domains 4.67e-27
Family Filamin repeat (rod domain) 0.00000655
Further Details:      
 
Domain Number 14 Region: 764-879
Classification Level Classification E-value
Superfamily E set domains 1.2e-26
Family Filamin repeat (rod domain) 0.00077
Further Details:      
 
Domain Number 15 Region: 560-661
Classification Level Classification E-value
Superfamily E set domains 3.4e-26
Family Filamin repeat (rod domain) 0.00015
Further Details:      
 
Domain Number 16 Region: 274-370
Classification Level Classification E-value
Superfamily E set domains 1.27e-25
Family Filamin repeat (rod domain) 0.0007
Further Details:      
 
Domain Number 17 Region: 374-473
Classification Level Classification E-value
Superfamily E set domains 1.27e-25
Family Filamin repeat (rod domain) 0.00088
Further Details:      
 
Domain Number 18 Region: 1625-1737
Classification Level Classification E-value
Superfamily E set domains 2.4e-25
Family Filamin repeat (rod domain) 0.0000568
Further Details:      
 
Domain Number 19 Region: 2471-2563
Classification Level Classification E-value
Superfamily E set domains 7.34e-25
Family Filamin repeat (rod domain) 0.00000336
Further Details:      
 
Domain Number 20 Region: 2602-2703
Classification Level Classification E-value
Superfamily E set domains 2.67e-24
Family Filamin repeat (rod domain) 0.00000385
Further Details:      
 
Domain Number 21 Region: 2378-2468
Classification Level Classification E-value
Superfamily E set domains 2.47e-23
Family Filamin repeat (rod domain) 0.00000441
Further Details:      
 
Domain Number 22 Region: 954-1055
Classification Level Classification E-value
Superfamily E set domains 5.54e-22
Family Filamin repeat (rod domain) 0.0032
Further Details:      
 
Domain Number 23 Region: 2213-2294
Classification Level Classification E-value
Superfamily E set domains 8.01e-20
Family Filamin repeat (rod domain) 0.0001
Further Details:      
 
Domain Number 24 Region: 1925-2020
Classification Level Classification E-value
Superfamily E set domains 1.07e-17
Family Filamin repeat (rod domain) 0.0001
Further Details:      
 
Domain Number 25 Region: 1759-1839
Classification Level Classification E-value
Superfamily E set domains 4.94e-17
Family Filamin repeat (rod domain) 0.0000436
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000099139   Gene: ENSMUSG00000068699   Transcript: ENSMUST00000101617
Sequence length 2704
Comment pep:novel chromosome:GRCm38:6:29433276:29461849:1 gene:ENSMUSG00000068699 transcript:ENSMUST00000101617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMNNSNYSDASGLGLVDEADEMPSTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVGKRLTD
LQRDLSDGLRLIALLEVLSQKRMYRKFHPRPNFRQMKLENVSVALEFLEREHIKLVSIDS
KAIVDGNLKLILGLIWTLILHYSISMPMWEDEDDEDARKQTPKQRLLGWIQNKVPQLPIT
NFNRDWQDGKALGALVDNCAPGLCPDWEAWDPNQPVQNAREAMQQADDWLGVPQVIAPEE
IVDPNVDEHSVMTYLSQFPKAKLKPGAPVRSKQLNPKKAIAYGPGIEPQGNTVLQPAHFT
VQTVDAGVGEVLVYIEDPEGHTEEAKVVPNNDKDRTYAVSYVPKVAGLHKVTVLFAGQNI
ERSPFEVNVGMALGDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDPQG
RRDTVEVALEDKGDNTFRCTYRPVMEGPHTVHVAFAGAPITRSPFPVHVAEACNPNACRA
SGRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKGTEEPVKVREAGDGVFECEYYP
VVPGKYVVTITWGGYAIPRSPFEVQVSPEAGAQKVRAWGPGLETGQVGKSADFVVEAIGT
EVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHIQ
PAPPDCFPDKVKAFGPGLEPTGCIVDRPAEFTIDARAAGKGDLKLYAQDADGCPIDIKVI
PNGDGTFRCSYVPTKPIKHTIIVSWGGVNVPKSPFRVNVGEGSHPERVKVYGPGVEKTGL
KANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPVEADIDFDIIKNDNDTFTVKYTPPGAG
HYTIMVLFANQEIPASPFHIKVDPSHDASKVKAEGPGLSRTGVEVGKPTHFTVLTKGAGK
AKLDVHFAGAAKGEAVRDFEIIDNHDYSYTVKYTAVQQGNMAVTVTYGGDPVPKSPFVVN
VAPPLDLSKVKVQGLNSKVAVGQEQAFSVNTRGAGGQGQLDVRMTSPSRRPIPCKLEPGG
GAEAQAVRYMPPEEGPYKVDITYDGHPVPGSPFAVEGVLPPDPSKVCAYGPGLKGGLVGT
PAPFSIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCAVSYLPTEPGEYTINILFAEAH
IPGSPFKATIQPVFDPSKVRASGPGLERGKAGEAATFTVDCSEAGEAELTIEILSDAGVK
AEVLIQNNADGTYHITYSPAFPGTYTITIKYGGHPIPKFPTRVHVQPAVDTSGIKVSGPG
VEPHGVLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAY
EEGVHLVEVLYDEVAVPKSPFRVGVTEGCDPTRVRAFGPGLEGGLVNKANRFTVETRGAG
TGGLGLAIEGPSEAKMSCKDNKDGSCTVEYIPFTPGDYDVNITFGGQPIPGSPFRVPVKD
VVDPGKVKCSGPGLGTGVRARVPQTFTVDCSQAGRAPLQVAVLGPTGVAEPVEVRDNGDG
THTVHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPSHDASKVRASGPGLNASGIPASLP
VEFTIDARDAGQGLLTVQILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKYGGD
EIPYSPFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQIGEETVITVDAKAAGKGKVT
CTVSTPDGAELDVDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLATEEPV
VPVEPLESMLRPFNLVIPFTVQKGELTGEVRMPSGKTARPNITDNKDGTITVRYAPTEKG
LHQMGIKYDGNHIPGSPLQFYVDAINSRHVSAYGPGLSHGMVNKPATFTIVTKDAGEGGL
SLAVEGPSKAEITCKDNKDGTCTVSYLPTAPGDYSIIVRFDDKHIPGSPFTAKITGDDSM
RTSQLNVGTSTDVSLKITEGDLSQLTASIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGE
HVVSVRKSGKHVTNSPFKILVGPSEIGDASKVRVWGKGLSEGQTFQVAEFIVDTRNAGYG
GLGLSIEGPSKVDINCEDMEDGTCKVTYCPTEPGTYIINIKFADKHVPGSPFTVKVTGEG
RMKESITRRRQAPSIATIGSTCDLNLKIPGNWFQMVSAQERLTRTFTRSSHTYTRTERTE
ISKTRGGETKREVRVEESTQVGGDPFPAVFGDFLGRERLGSFGSITRQQEGEASSQDMTA
QVTSPSGKTEAAEIVEGEDSAYSVRFVPQEMGPHTVTVKYRGQHVPGSPFQFTVGPLGEG
GAHKVRAGGTGLERGVAGVPAEFSIWTREAGAGGLSIAVEGPSKAEIAFEDRKDGSCGVS
YVVQEPGDYEVSIKFNDEHIPDSPFVVPVASLSDDARRLTVTSLQETGLKVNQPASFAVQ
LNGARGVIDARVHTPSGAVEECYVSELDSDKHTIRFIPHENGVHSIDVKFNGAHIPGSPF
KIRVGEQSQAGDPGLVSAYGPGLEGGTTGVSSEFIVNTQNAGSGALSVTIDGPSKVQLDC
RECPEGHVVTYTPMAPGNYLIAIKYGGPQHIVGSPFKAKVTGPRLSGGHSLHETSTVLVE
TVTKSSSSRGASYSSIPKFSSDASKVVTRGPGLSQAFVGQKNSFTVDCSKAGMFHPRGLS
WGGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVKEKGDYILIVKWGDESVPGSPFK
VNVP
Download sequence
Identical sequences ENSMUSP00000099139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]