SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000099383 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000099383
Domain Number 1 Region: 139-310
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 1.47e-49
Family Acyl-CoA thioesterase 0.00013
Further Details:      
 
Domain Number 2 Region: 29-135
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 1.62e-37
Family Acyl-CoA thioesterase 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000099383   Gene: ENSMUSG00000017307   Transcript: ENSMUST00000103094
Sequence length 320
Comment pep:known chromosome:GRCm38:2:164792768:164804882:-1 gene:ENSMUSG00000017307 transcript:ENSMUST00000103094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAPEGLGDAHGDADRGDLSGDLRSVLVTSVLNLEPLDEDLYRGRHYWVPTSQRLFGGQI
MGQALVAAAKSVSEDVHVHSLHCYFVRAGDPKVPVLYHVERIRTGASFSVRAVKAVQHGK
AIFICQASFQQMQPSPLQHQFSMPSVPPPEDLLDHEALIDQYLRDPNLHKKYRVGLNRVA
AQEVPIEIKVVNPPTLTQLQALEPKQMFWVRARGYIGEGDIKMHCCVAAYISDYAFLGTA
LLPHQSKYKVNFMASLDHSMWFHAPFRADHWMLYECESPWAGGSRGLVHGRLWRRDGVLA
VTCAQEGVIRLKPQVSESKL
Download sequence
Identical sequences P58137 Q3U965
NP_573503.2.92730 399884 ENSMUSP00000017451 ENSMUSP00000099383 ENSMUSP00000099383 10090.ENSMUSP00000099383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]