SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000099482 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000099482
Domain Number 1 Region: 6-189
Classification Level Classification E-value
Superfamily ITPase-like 1.47e-63
Family ITPase (Ham1) 0.000000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000099482   Gene: ENSMUSG00000074797   Transcript: ENSMUST00000103193
Sequence length 198
Comment pep:known chromosome:GRCm38:2:130667610:130681614:1 gene:ENSMUSG00000074797 transcript:ENSMUST00000103193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASLVGKKIVFVTGNAKKLEEVIQILGDNFPCTLEAQKIDLPEYQGEPDEISIQKCREA
ARQVQGPVLVEDTCLCFNALGGLPGPYIKWFLQKLKPEGLHQLLAGFEDKSAYALCTFAL
STGDPSQPVLLFRGQTSGQIVMPRGSRDFGWDPCFQPDGYEQTYAEMPKSEKNTISHRFR
ALHKLQEYFSVAAGAGDH
Download sequence
Identical sequences Q60I30 Q9D892
ENSMUSP00000099482 ENSMUSP00000099482 ENSMUSP00000099482 400246 NP_080198.2.92730 XP_017171220.1.92730 10090.ENSMUSP00000099482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]