SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000099625 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000099625
Domain Number 1 Region: 280-408
Classification Level Classification E-value
Superfamily ApaG-like 1.06e-40
Family ApaG-like 0.00021
Further Details:      
 
Domain Number 2 Region: 99-265
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 2.45e-21
Family SMI1/KNR4-like 0.0079
Further Details:      
 
Domain Number 3 Region: 6-82
Classification Level Classification E-value
Superfamily F-box domain 2.88e-16
Family F-box domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000099625   Gene: ENSMUSG00000027180   Transcript: ENSMUST00000102565
Sequence length 415
Comment pep:known chromosome:GRCm38:2:104027860:104057504:1 gene:ENSMUSG00000027180 transcript:ENSMUST00000102565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVEAETGLLTLESLPTDPLLLILSFVDYRDLINCCYVSRRLSQLSTHDPLWRRHCKKY
WLISEEEKAGKSQCWRSLFIETYSDVGRYIDHYAAIKKAWRDLKKYLEPRCPRMVLSLKE
GAREEDLDAVEAQIGCKLPDDYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTA
AGGFQQRQGLKYCLPLTFCIHTGLSQYIAVEAAEGRNKNEVFYQCPDQMARNPAAIDMFI
IGATFTDWFTSYVNNVVSGGFPIIRDQIFRYIHDPECVATTGDITVSVSTSFLPELSSVH
PPHYFFTYRIRIEMSRDALPEKACQLDSRYWRITNAKGDVEEVQGPGVVGEFPIISPGRI
YEYTSCTTFSTTSGYMEGYYTFHFLYFKDKVFNVAIPRFHMACPTFRVSIARLVS
Download sequence
Identical sequences NP_065618.1.92730 ENSMUSP00000099625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]