SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000099677 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000099677
Domain Number 1 Region: 26-366
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 4.05e-70
Family ADP-ribosylglycohydrolase 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000099677   Gene: ENSMUSG00000042558   Transcript: ENSMUST00000102617
Sequence length 370
Comment pep:known chromosome:GRCm38:4:126316047:126321703:-1 gene:ENSMUSG00000042558 transcript:ENSMUST00000102617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVAAAAAATAMSAAGGGGASAARSISRFRGCLAGALLGDCVGAVYEAHDTVSLASVLSH
VESLEPDPGTPGSARTETLYYTDDTAMTRALVQSLLAKEAFDEVDMAHRFAQEYKKDPDR
GYGAGVITVFKKLLNPKCRDVYEPARAQFNGKGSYGNGGAMRVAGISLAYSSVQDVQKFA
RLSAQLTHASSLGYNGAILQALAVHLALQGVSSSEHFLEQLLGHMEELEGDAQSVLDAKE
LGMEERPYSSRLKKVGELLDQDVVSREEVVSELGNGIAAFESVPTAIYCFLRCMEPHPEI
PSTFNSLQRTLIYSISLGGDTDTIATMAGAIAGAYYGMEQVPESWQQSCEGFEETDVLAQ
SLHRVFQESS
Download sequence
Identical sequences Q8CG72
10090.ENSMUSP00000099677 NP_598644.1.92730 ENSMUSP00000099677 ENSMUSP00000099677 ENSMUSP00000099677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]