SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000100350 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000100350
Domain Number 1 Region: 23-111
Classification Level Classification E-value
Superfamily Immunoglobulin 9.2e-24
Family V set domains (antibody variable domain-like) 0.0000346
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000100350   Gene: ENSMUSG00000076764   Transcript: ENSMUST00000103573
Sequence length 112
Comment pep:known chromosome:GRCm38:14:52667411:52667864:1 gene:ENSMUSG00000076764 transcript:ENSMUST00000103573 gene_biotype:IG_LV_gene transcript_biotype:IG_LV_gene
Sequence
MNTSPALVTVMLLFMLRTHGNSVTQMQGQVTLSEEEFLFINCTYSTTGYPTLFWYVQYPG
EGPQLLLKVTTANNKGSSRGFEATYDKGTTSFHLQKASVQESDSAVYYCVLG
Download sequence
Identical sequences A0A075B5Z9
ENSMUSP00000100350 ENSMUSP00000100350 ENSMUSP00000100350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]