SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000100985 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000100985
Domain Number 1 Region: 5-53
Classification Level Classification E-value
Superfamily DNA-binding domain 0.000000000000752
Family Methyl-CpG-binding domain, MBD 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000100985   Gene: ENSMUSG00000035478   Transcript: ENSMUST00000105348
Sequence length 281
Comment pep:novel chromosome:GRCm38:10:80392839:80399422:-1 gene:ENSMUSG00000035478 transcript:ENSMUST00000105348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERKSPSGKKFRSKPQLARYLGGSMDLSTFDFRTGKMLMNKMNKSRQRVRYDSSNQVKAL
AKHLPGPSNPPWTPVGAARCRVFSPQGKPDLNTALPVRQTASIFKQPVTKITNHPSNKVK
SDPQKAVDQPRQLFWEKKLSGLSAFDIAEELVRTMDLPKGLQGVGPGCTDETLLSAIASA
LHTSTLPITGQLSAAVEKNPGVWLNTAQPLCKAFMVTDDDIRKQEELVQQVRKRLEEALM
ADMLAHVEELARDGEAPLDKACAEEEEEEEEEEEEPEPERV
Download sequence
Identical sequences D3YTR4
ENSMUSP00000100985 XP_006513366.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]