SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000101308 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000101308
Domain Number 1 Region: 2-221
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.1e-66
Family Carbonic anhydrase 0.0000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000101308   Gene: ENSMUSG00000028972   Transcript: ENSMUST00000105683
Sequence length 261
Comment pep:novel chromosome:GRCm38:4:150187015:150198470:-1 gene:ENSMUSG00000028972 transcript:ENSMUST00000105683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFNPSLKPLSLVNYEKENLEFTMTNNGHTVSIDLPPSMYLETSDGTEFISKAFHFHWGGR
DWELSGSEHTIDGIRSIMEAHFVHFNKEYGTYENAKDQKNGLAVLAVLFKIDEYAENTYY
SDIISALKNIEKPGETTTLKDTTIRNLLPKDVHHYYTYPGSLTTPPCTENVQWFVLRDKV
TLSKAQVVTIENSVMDHNNNTIQNGYRSTQPNNHRVVEANFLNVQDMYSSYHLYLKNMQK
EILQPKKQKKTKKNRHFWSRK
Download sequence
Identical sequences B1ARR4
ENSMUSP00000101308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]