SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000101683 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000101683
Domain Number 1 Region: 45-284
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.63e-61
Family Alanine racemase-like, N-terminal domain 0.0000000732
Further Details:      
 
Domain Number 2 Region: 249-397
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 3.98e-29
Family Eukaryotic ODC-like 0.0000492
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000101683   Gene: ENSMUSG00000028789   Transcript: ENSMUST00000106068
Sequence length 459
Comment pep:known chromosome:GRCm38:4:128932022:128962428:-1 gene:ENSMUSG00000028789 transcript:ENSMUST00000106068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGYLSESDFVMVEEGFSTRDLLEELTLGASQATSGKVAAFFVADLGAVVRKHFCFLKHL
PRVRPFYAVGCNSSLGVLKVLAELGLGFSCANKAEMELVQHIGVPASKIICANPCKQVAQ
IKYAAKHGVRLLSFDNEVELAKVVKSHPSAKMVLCIATQDSHSLNHLSLRFGASLKSCRH
LLENAKKSHVEVVGVSFHIGSGCPDPQAYAQSIADARLVFQMGEELGHTMNILDLGGGFP
GLEGAKVRFEEMASVINSALDLYFPEGCGVDILAELGRYYVTSAFTVAVSIVAKREVLDQ
ASREEQTGAAPKSIVYYLDEGVYGVFNSVLFDNTCPTPALQKKPSADQPLYSSSLWGPAV
EGCDCVAEGLWLPQLQVGDWLVFDNMGAYTVDTKSLLGGTQARRVTYAMSRLAWEALRGQ
LLPAEEDQDAEGVCKPLSCGWEITDTLCVGPVFTPASIM
Download sequence
Identical sequences B2RSR5 Q8BVM4
ENSMUSP00000030581 ENSMUSP00000101683 10090.ENSMUSP00000030581 ENSMUSP00000101683 NP_766463.1.92730 ENSMUSP00000030581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]